KEGG   Mus musculus (mouse): 22284Help
Entry
22284             CDS       T01002                                 

Gene name
Usp9x, 5730589N07Rik, AA407302, AA407699, AL022658, AL022749, Dffrx, FAF-X, Fafl
Definition
ubiquitin specific peptidase 9, X chromosome (EC:3.4.19.12)
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     22284 (Usp9x)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   22284 (Usp9x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A1.1; X 7.95 cM
AA seq 2554 aa AA seqDB search
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQI
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLAQDWFPLLELLAMALNP
HCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGSSEDEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQSQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRMYGRDNEDYDPQTVRLGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIACRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFIVRFPNQGRQVD
DLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVGGELIDPGDDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPAGAPLTDDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTSVNQVTHDQAVVLQS
ALQSIPNPSSECMLRNVSVRLAQQISDEASRYMPDICVIRAIQKIIWTSGCGGLQLVFSP
NEEVTKIYEKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDDVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKFHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPATINA
GFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PQQFEDKPPLSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQNEQSESEKAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIGHDDEVIRYISEIAITTRPHQ
IVMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPGQDHLSPEAEEI
TMISIQLAARFLFTTGFHTKKIVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRF
SEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAV
LNLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKY
QYAELGKLYSVVSQLIRCCNVSSRMQSSINGNPSLPNPFGDPNLSQPIMPIQQNVVDILF
VRTSYVKKIIEDCSNSDETVKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLL
LQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPV
AYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERS
HSARMTLAKACELCPEEEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTG
PAAHHMNNPQRTGQRAQENYEGGEEVSPPQTKDQ
NT seq 7665 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagttggagggaatgacaaccagggccaagcccct
gatggacagtctcagccccccctccaacagaatcagacttcatcgcctgattcgtccaat
gaaaattcccctgcaactcctcctgatgagcaaggtcaaggtgatgctcctccacagatt
gaagatgaggaacctgcatttccacacactgacttggcaaagttagatgatatgatcaac
aggcctcgatgggttgttccagttttgccgaaaggggaattagaagtgcttttagaagct
gctattgatcttagtaagaaaggccttgatgttaaaagtgaagcatgtcagcgatttttc
cgagatgggctaacgatctcatttacaaaaatcctgacagatgaagcagtgagtggctgg
aagtttgaaattcacagatgcattattaacaatactcatcgcctggtggagctatgtgtg
gctaagttagcccaagactggtttccacttctagaacttcttgccatggccttaaatcct
cattgcaaattccatatctacaatggtacacgtccctgcgagtcagtgtcctcaagtgtt
cagttgcctgaagatgaactctttgctcgttctccagaccctcgatcaccaaaaggttgg
ctagtggatctcctcaacaagtttggcactttaaatggattccagatactgcacgatcgt
tttattaatggatcagcattaaacgttcagataattgcagcccttattaaaccatttgga
cagtgctatgagtttcttactcttcacacagtgaaaaagtactttcttccaataatagaa
atggttccacagtttttagaaaacttaactgatgaagagctgaagaaagaagcaaagaat
gaagccaaaaatgatgctctttcaatgattattaaatcattgaagaatttagcttcgcgg
gttcctggacaagaagaaactgtaaaaaacttagaaatatttaggttaaaaatgatactt
agattgttgcaaatttcttctttcaatggaaagatgaatgcactgaatgaggttaataag
gtgatttccagtgtgtcatactatacccatcggcatggcagttctgaggatgaagagtgg
cttacagcagagaggatggctgaatggatacagcagaacaatattttatccatagtttta
cgagatagccttcatcaaccacagtatgtagagaaactagaaaagattcttcgctttgtc
ataaaagaaaaagctctgaccttgcaagatcttgataatatctgggcagcacaggcaggg
aaacatgaagccattgtaaagaatgtacatgatctactggccaaattggcatgggatttt
tctcctgaacaacttgatcatctttttgattgctttaaggccagttggacaaatgcaagt
aaaaagcaacgtgaaaagctccttgagctgattcgtcgtcttgcagaagatgataaagat
ggtgtgatggcacataaagtattgaaccttctgtggaatctagctcacagtgatgatgtg
cctgtagatatcatggatttggctctcagtgctcacatcaaaatactagattatagttgc
tcccaggaccgggacacccaaaagatccagtggattgatcgcttcatagaagaacttcgc
acaaatgacaaatgggtcattcctgcactgaaacaaattagagaaatttgtagtttgttt
ggtgaagcacctcaaaatttgagtcaaagtcagcgaagtccccatgtattttatcgccat
gacttaatcaatcaacttcagcacaatcatgccctagttactttggtagcagaaaacctt
gcaacttacatggaaagcatgagaatgtatggcagagacaatgaagactatgacccacaa
actgtgagactgggaagtagatatagtcatgttcaagaagtccaagaacggcttaacttt
cttaggtttttattgaaggatggccagctgtggctgtgtgctccacaggcaaaacaaata
tggaagtgcttagcagagaatgcggtttatctttgtgatcgtgaagcctgttttaagtgg
tattccaaattaatgggagacgaacctgacttagatcctgatatcaataaggacttcttt
gaaagtaatgtgcttcagcttgatccttccctgttaactgaaaatgggatgaagtgtttt
gagagattcttcaaagctgtgaattgtcgagaaggaaaactagtagcaaaaagaagagcc
tacatgatggatgatttggaattgataggattagactatctttggagagttgtaattcag
agtaatgatgatattgcctgccgagctattgatctccttaaagagatatacacaaacctt
ggtccaaggctgcaggtcaatcaggtggtgatccatgaagacttcattcagtcttgcttt
gatcgtttgaaagcctcttatgacacattgtgtgttttggatggtgacaaagacagtatt
aattgtgcaagacaggaagctgttcgaatggtccgagtgttaactgttctaagagaatat
ataaatgaatgtgacagtgattatcatgaagaaagaacaattttgcctatgtcaagagct
ttccgtggtaaacacctctcttttatagttcgatttccaaaccagggcaggcaagtagat
gacttggaggtttggtctcatacaaatgataccattggttcagttcgaagatgtatactc
aatcgtattaaagccaatgtagctcatacaaaaattgaactctttgtgggtggtgagctt
attgatcctggagatgaccgaaagttgattggacaattaaacctaaaagataaatcacta
attacagccaaacttacacaaataagctccaatatgccttcaagtcctgatagctcctct
gattcctcaactggatctcctggaaatcatggtaatcattacagtgatggccccaatcca
gaagtggaaagttgtttgcctggagtgataatgtcacttcatcccagatacatctctttc
ctttggcaagttgcagacttagggagcagcctaaatatgccacctcttagagatggagca
agagtgcttatgaaacttatgccgccagatagtacgacaatagaaaagttaagagctatt
tgtttggaccatgccaaacttggagaaagcagccttagtccatctcttgactcacttttc
tttggtccttcagcctcacaagtgctatacctaacagaggtagtctatgccttgttaatg
cccgctggtgcacccttgactgatgattcctcggattttcagtttcacttcttgaaaagt
ggtggtctgccccttgtcctgagtatgctaaccagaaataacttcctaccaaatgcagat
atggaaactcgaaggggtgcctacctcaatgctcttaaaatagccaaactgttactaact
gccattggctatggccatgttcgtgctgtggcagaagcttgtcaaccaggtgtagaaggc
gtgaatcctatgacatcggtcaaccaagtaactcatgatcaagcagtggtgctacaaagt
gcccttcagagcattcctaacccatcatctgaatgcatgcttagaaacgtgtctgttcgc
cttgctcagcagatttctgatgaggcttcaagatatatgcctgatatttgtgtaattaga
gctatacaaaaaattatttggacatcaggatgtggaggattacagctggtattcagccca
aatgaagaagtgacaaaaatttatgagaagaccaatgcaggcaatgagccagacctcgaa
gatgaacaggtttgctgtgaagcattggaggtgatgacactgtgtttcgccttgattcca
acagccttagatgctctaagtaaagaaaaagcttggcagacatttattattgacttactg
ttgcactgtcacagcaaaactgttcgtcaagtggcacaggaacaattcttcttaatgtgc
accagatgttgcatggggcacaggcctctacttttcttcattacgctgctctttactgtt
ttggggagcacagccagagagagggctaaacactcaggcgactactttactcttttaaga
catcttcttaattacgcctacaacagtaacattaatgtgcccaatgctgaagttcttcta
aataatgaaattgattggcttaaaagaattagggatgatgttaaaaggacaggtgaaaca
ggtgttgaggagacaatcttagaaggacaccttggggttacaaaggagctactggctttt
cagactcctgagaaaaagtttcatattggttgtgaaaagggaggtgctaatctcattaaa
gaattaatcgacgacttcatctttcccgcatccaatgtttacctgcagtatatgagaaat
ggagaactccctgctgagcaggccattcctgtgtgtggttcaccagccacaattaatgct
ggttttgagttacttgtggcattagctgttggctgtgtgaggaacctcaaacagatagta
gattctttgactgaaatgtattacattggtacagcaataactacttgtgaagcacttact
gagtgggaatacctgccacccgttggaccccgtccaccaaaaggatttgtggggctgaaa
aatgctggtgctacttgttacatgaactctgtgatccagcaactctatatgatcccctct
atcaggaatggtattcttgccatagaaggcacaggtagtgatgtagatgatgatatgtct
ggggatgagaagcaggacaacgagagcaatgttgatcccagggatgatgtgtttggatat
cctcaacaatttgaagacaaaccaccactgagtaaaacagaagataggaaagagtacaat
attggtgttctaagacaccttcaggttatctttggccatttagctgcttctcgactacag
tactatgtgcctagaggattttggaaacagttcaggctttggggtgagcctgtcaatctt
cgtgaacaacatgatgctttagagttctttaattctttggtggatagtttagatgaagct
ttaaaagccttagggcatccagctatgctaagtaaagtcttgggaggttcctttgctgat
cagaaaatttgccaaggctgcccacataggtacgaatgtgaagaatcttttacgactctg
aatgtagacattagaaaccaccaaaatcttctggattctttggaacagtatgtcaaagga
gacttactagaaggagcaaatgcttatcattgtgaaaaatgcaataaaaaggttgatact
gtaaagcgcttgctaattaaaaaattgcctcctgttcttgctatccaactaaaacgattc
gattatgactgggaaagagaatgtgcaatcaagttcaatgattactttgaatttcctcga
gagttagacatggaaccttacacagtggcaggtgttgctaaactggagggagataatgtc
aacccagaaagtcagctgatacaacagaatgagcagtctgaaagcgagaaagcaggaagc
acaaaatacagacttgtgggtgtgcttgtgcacagtggtcaagcaagtggcggacattac
tattcttacatcattcagaggaatggaggggatggtgaaaaaaatcgttggtataaattt
gatgatggagatgtaacggaatgtaaaatggatgacgatgaagaaatgaaaaaccagtgt
tttgggggagagtacatgggagaagtatttgatcacatgatgaagcgcatgtcgtacagg
cgtcagaaaagatggtggaatgcatatatacttttttatgaacgaatggacacaataggt
catgatgatgaggtgataagatacatatcagagattgctatcaccacaaggccccatcag
attgtcatgccatccgccattgaaagaagtgttcggaagcagaatgttcagttcatgcac
aaccgaatgcagtacagtctggaatattttcagtttatgaaaaagctactgacatgtaat
ggtgtttacttaaaccctcctccagggcaagatcacctgtctcctgaagcagaagaaatc
actatgattagtattcagcttgctgctaggttcctttttactacaggatttcacacaaag
aaaatagtccgaggatctgccagtgattggtatgatgcattgtgtattctcctgcgtcac
agcaagaacgtgcggttttggtttgctcacaatgtcctttttaatgtttcaaatcgattc
tctgagtaccttttggaatgccctagtgcagaagtgagaggtgcatttgcaaagctcata
gttttcattgcacatttttccttacaagacgggccttgtccttcaccttttgcatctcct
ggaccttctagtcaggcttatgacaacttaagtttgagtgaccacttactaagagcagta
ctaaatctcttgcggagggaggtttcagagcatggacgtcatttacagcagtatttcaac
ttgttcgtaatgtatgccaatttaggagtggcagagaaaacacagctgctcaaactgagt
gtacctgctacctttatgcttgtgtccttagatgaaggtcctggccctccaattaaatat
cagtatgctgaattaggcaaattatactcagtagtgtcacagctcatccgctgttgcaat
gtctcttcaagaatgcagtcttcgatcaatggtaatccttctcttccaaatccttttggt
gatcctaacttatcacaacctataatgccaattcaacaaaatgtggtagacattttattt
gtgagaacaagttatgtgaagaaaattattgaagactgcagtaactctgatgagaccgtc
aaattgcttcgcttttgctgctgggagaatcctcagttctcatctactgtcctcagtgaa
cttctttggcaggttgcatattcttatacttatgaactccggccctatttggatctgctt
ttacaaatcttactgattgaagactcttggcagactcacagaattcataatgcccttaaa
ggaattccagatgaccgagatgggctgtttgacacaattcagcgttctaagaatcactat
caaaaaagagcataccagtgtataaaatgtatggtagccctctttagcagttgtcctgtt
gcttaccaaatcctgcagggcaatggagatcttaaaaggaaatggacctgggcagtggag
tggcttggagatgaacttgaaagaagaccatacactggcaatcctcagtacacttacaac
aattggtctcctccagtgcaaagcaatgaaacatcaaatggttatttcttagagagatca
cacagcgctaggatgacacttgcaaaagcttgtgaactctgtcctgaggaggaaccagat
gaccaagatgccccagatgagcatgaatcacctccaccagaagatgctcctttataccct
cattcccctggatctcaatatcagcagaataaccatgtgcatggacagccatatacaggc
ccagcagcacatcacatgaacaaccctcagagaactggccaacgagcacaagaaaattat
gaaggcggtgaagaagtgtcccctcctcagaccaaggatcagtga

DBGET integrated database retrieval system