KEGG   Mus musculus (mouse): 22333Help
Entry
22333             CDS       T01002                                 

Gene name
Vdac1, AL033343, Vdac5, mVDAC1, mVDAC5
Definition
(RefSeq) voltage-dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05012  Parkinson's disease
mmu05016  Huntington's disease
mmu05164  Influenza A
mmu05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    22333 (Vdac1)
   04022 cGMP - PKG signaling pathway
    22333 (Vdac1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    22333 (Vdac1)
   04218 Cellular senescence
    22333 (Vdac1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    22333 (Vdac1)
  Digestive system
   04979 Cholesterol metabolism
    22333 (Vdac1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    22333 (Vdac1)
   05016 Huntington's disease
    22333 (Vdac1)
  Infectious diseases
   05166 HTLV-I infection
    22333 (Vdac1)
   05164 Influenza A
    22333 (Vdac1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22333 (Vdac1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   22333 (Vdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 22333
NCBI-ProteinID: NP_035824
MGI: 106919
Ensembl: ENSMUSG00000020402
Vega: OTTMUSG00000005626
UniProt: Q60932
Structure
PDB: 

Jmol
Position
11 B1.3; 11 31.86 cM
AA seq 283 aa AA seqDB search
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcctcccacatacgccgatcttggcaagtccgccagggatgtcttcaccaag
ggctacggctttggcttaataaaacttgatttgaaaacgaagtcagagaatggattggaa
tttaccagctcaggctctgccaacacggaaaccaccaaagtgaacggcagcctggaaacc
aagtacagatggactgagtatgggctgacgtttacagagaagtggaacacagacaacacc
ctgggcactgagatcactgtggaagaccagcttgctcgtggactgaagctcacctttgat
tcgtcattctcgccgaacactgggaaaaaaaatgctaaaatcaagacagggtacaagagg
gagcacatcaacctcggctgtgacgtggactttgacatcgctgggccctcgatccggggc
gctctggtgcttggctatgagggttggctggctggctaccagatgaattttgagacctcg
aagtcccgagtgacccagagcaacttcgcagttggctataagacggatgaattccagctt
catactaatgtgaatgacgggacagagtttggtggctccatttaccagaaggtgaacaag
aagttggagactgctgtcaatctcgcctggactgcaggaaacagtaacactcgcttcgga
atagcagccaagtatcaggtcgaccctgatgcctgcttttcggccaaagtgaacaactct
agcctgattggcttagggtacactcagaccctaaaaccaggtatcaaactgacgttgtca
gccctgctcgatggcaagaacgtcaatgcgggtggccacaagcttggcctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system