KEGG   Mus musculus (mouse): 22333Help
Entry
22333             CDS       T01002                                 

Gene name
Vdac1, AL033343, Vdac5, mVDAC1, mVDAC5
Definition
(RefSeq) voltage-dependent anion channel 1
  KO
K05862  
voltage-dependent anion channel protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
NOD-like receptor signaling pathway
Parkinson's disease
Huntington's disease
Influenza A
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    22333 (Vdac1)
   04022 cGMP - PKG signaling pathway
    22333 (Vdac1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    22333 (Vdac1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    22333 (Vdac1)
   05016 Huntington's disease
    22333 (Vdac1)
  Infectious diseases
   05166 HTLV-I infection
    22333 (Vdac1)
   05164 Influenza A
    22333 (Vdac1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22333 (Vdac1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   22333 (Vdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 B1.3; 11 31.86 cM
AA seq 283 aa AA seqDB search
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcctcccacatacgccgatcttggcaagtccgccagggatgtcttcaccaag
ggctacggctttggcttaataaaacttgatttgaaaacgaagtcagagaatggattggaa
tttaccagctcaggctctgccaacacggaaaccaccaaagtgaacggcagcctggaaacc
aagtacagatggactgagtatgggctgacgtttacagagaagtggaacacagacaacacc
ctgggcactgagatcactgtggaagaccagcttgctcgtggactgaagctcacctttgat
tcgtcattctcgccgaacactgggaaaaaaaatgctaaaatcaagacagggtacaagagg
gagcacatcaacctcggctgtgacgtggactttgacatcgctgggccctcgatccggggc
gctctggtgcttggctatgagggttggctggctggctaccagatgaattttgagacctcg
aagtcccgagtgacccagagcaacttcgcagttggctataagacggatgaattccagctt
catactaatgtgaatgacgggacagagtttggtggctccatttaccagaaggtgaacaag
aagttggagactgctgtcaatctcgcctggactgcaggaaacagtaacactcgcttcgga
atagcagccaagtatcaggtcgaccctgatgcctgcttttcggccaaagtgaacaactct
agcctgattggcttagggtacactcagaccctaaaaccaggtatcaaactgacgttgtca
gccctgctcgatggcaagaacgtcaatgcgggtggccacaagcttggcctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system