KEGG   Mus musculus (mouse): 22335Help
Entry
22335             CDS       T01002                                 

Gene name
Vdac3
Definition
(RefSeq) voltage-dependent anion channel 3
  KO
K15041  
voltage-dependent anion channel protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
NOD-like receptor signaling pathway
Parkinson's disease
Huntington's disease
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    22335 (Vdac3)
   04022 cGMP - PKG signaling pathway
    22335 (Vdac3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    22335 (Vdac3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    22335 (Vdac3)
  Neurodegenerative diseases
   05012 Parkinson's disease
    22335 (Vdac3)
   05016 Huntington's disease
    22335 (Vdac3)
  Infectious diseases
   05166 HTLV-I infection
    22335 (Vdac3)
   05161 Hepatitis B
    22335 (Vdac3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22335 (Vdac3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   22335 (Vdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A2; 8 11.42 cM
AA seq 283 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRR
DCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacttattgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaagatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttcaggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgcaactatgggctcaccttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccaaacacaggaaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtctcggcagtaatgttgatatagatttttctggaccgaccatctatggc
tgggctgtgttggcctttgaaggttggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtctcagaataatttcgctcttggttacaaggctgcagacttccagctg
catactcacgtgaatgatggcactgagtttggaggctcaatctaccagaaagttaacgag
aggattgaaacgtcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaaatataagctggattgtagaacttctctatctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagaccctccgaccaggagtcaaactgaccctgtca
gctttaatagatggaaagaacttcaatgcaggaggccacaaggttggattgggatttgaa
ctggaggcttag

DBGET integrated database retrieval system