KEGG   Mus musculus (mouse): 22335Help
Entry
22335             CDS       T01002                                 

Gene name
Vdac3
Definition
(RefSeq) voltage-dependent anion channel 3
  KO
K15041  
voltage-dependent anion channel protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Ferroptosis
Necroptosis
Cellular senescence
NOD-like receptor signaling pathway
Cholesterol metabolism
Parkinson's disease
Huntington's disease
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    22335 (Vdac3)
   04022 cGMP - PKG signaling pathway
    22335 (Vdac3)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    22335 (Vdac3)
   04217 Necroptosis
    22335 (Vdac3)
   04218 Cellular senescence
    22335 (Vdac3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    22335 (Vdac3)
  Digestive system
   04979 Cholesterol metabolism
    22335 (Vdac3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    22335 (Vdac3)
  Neurodegenerative diseases
   05012 Parkinson's disease
    22335 (Vdac3)
   05016 Huntington's disease
    22335 (Vdac3)
  Infectious diseases
   05166 HTLV-I infection
    22335 (Vdac3)
   05161 Hepatitis B
    22335 (Vdac3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22335 (Vdac3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   22335 (Vdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A2; 8 11.42 cM
AA seq 283 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRR
DCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacttattgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaagatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttcaggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgcaactatgggctcaccttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccaaacacaggaaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtctcggcagtaatgttgatatagatttttctggaccgaccatctatggc
tgggctgtgttggcctttgaaggttggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtctcagaataatttcgctcttggttacaaggctgcagacttccagctg
catactcacgtgaatgatggcactgagtttggaggctcaatctaccagaaagttaacgag
aggattgaaacgtcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaaatataagctggattgtagaacttctctatctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagaccctccgaccaggagtcaaactgaccctgtca
gctttaatagatggaaagaacttcaatgcaggaggccacaaggttggattgggatttgaa
ctggaggcttag

DBGET integrated database retrieval system