KEGG   Mus musculus (mouse): 22337Help
Entry
22337             CDS       T01002                                 

Gene name
Vdr, Nr1i1
Definition
(RefSeq) vitamin D receptor
  KO
K08539  
vitamin D3 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Endocrine and other factor-regulated calcium reabsorption
Mineral absorption
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    22337 (Vdr)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    22337 (Vdr)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    22337 (Vdr)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22337 (Vdr)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    22337 (Vdr)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   22337 (Vdr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 F1
AA seq 422 aa AA seqDB search
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPIRADVSTGSYSPRPTLSFSGDSSS
NSDLYTPSLDMMEPASFSTMDLNEEGSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFA
KMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTLDDMSWDCGSQDYKYDITDVSRAGH
TLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQT
YIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNE
IS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaatggcagccagcacctccctgcctgaccctggtgactttgaccggaatgtg
cctcggatctgtggagtgtgtggagaccgagccacgggcttccacttcaacgctatgacc
tgtgaaggctgcaagggtttcttcaggcggagcatgaagcgcaaggccctgttcacctgc
cccttcaatggagattgccgcatcaccaaggacaaccggcgacactgccaggcctgccgg
ctcaaacgctgcgtggacattggcatgatgaaggagttcatcctcacagatgaggaggtg
cagcgtaagcgagagatgatcatgaagaggaaggaggaagaggccttgaaggacagtctg
aggcccaagctgtctgaggagcaacagcacattatcgccatcctgctcgatgcccaccac
aagacctacgaccccacctatgccgacttccgggacttccggcctccaattcgtgcagac
gtaagtacagggagctattctccaaggcccacactcagcttctccggagactcctcctca
aactctgatctgtacaccccctcactggacatgatggaaccggccagcttttccacgatg
gatctgaatgaagaaggctccgatgacccctctgtgaccctggacctgtctccgctctcc
atgctgccccacctggctgatcttgtcagttacagcatccaaaaggtcatcggctttgcc
aagatgatccctggcttcagggacctcacctctgatgaccagattgtcctgcttaagtca
agtgccattgaggtgatcatgttgcgctccaaccagtcttttaccttggatgacatgtcc
tgggactgtggcagccaagactacaaatatgacatcactgatgtctccagagctgggcac
accctggagctgatcgaacccctcataaagttccaggtggggctgaagaagctgaacctc
catgaggaagaacatgtgctgctcatggccatctgcattgtctccccagaccgacctggg
gtacaggatgctaagctggttgaagccattcaggaccgcctatccaacacactgcagacc
tacatccgctgccgccacccgcccccgggcagccaccagctctacgccaagatgatccag
aagctggctgacctgcgaagcctcaatgaggagcactccaaacagtaccgttccctctcc
ttccagccggagaacagcatgaagctcacaccccttgtgctagaggtgttcggcaatgag
atctcctga

DBGET integrated database retrieval system