KEGG   Mus musculus (mouse): 22339Help
Entry
22339             CDS       T01002                                 

Gene name
Vegfa, Vegf, Vpf
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  
vascular endothelial growth factor A
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    22339 (Vegfa)
   04015 Rap1 signaling pathway
    22339 (Vegfa)
   04370 VEGF signaling pathway
    22339 (Vegfa)
   04066 HIF-1 signaling pathway
    22339 (Vegfa)
   04151 PI3K-Akt signaling pathway
    22339 (Vegfa)
   04150 mTOR signaling pathway
    22339 (Vegfa)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    22339 (Vegfa)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    22339 (Vegfa)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    22339 (Vegfa)
   05206 MicroRNAs in cancer
    22339 (Vegfa)
   05205 Proteoglycans in cancer
    22339 (Vegfa)
   05212 Pancreatic cancer
    22339 (Vegfa)
   05211 Renal cell carcinoma
    22339 (Vegfa)
   05219 Bladder cancer
    22339 (Vegfa)
  Immune diseases
   05323 Rheumatoid arthritis
    22339 (Vegfa)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    22339 (Vegfa)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    22339 (Vegfa)
Cytokines [BR:mmu04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    22339 (Vegfa)
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   22339 (Vegfa)
  NRP2; neuropilin 2 [KO:K06819]
   22339 (Vegfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   22339 (Vegfa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 C; 17 22.79 cM
AA seq 214 aa AA seqDB search
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggagagcagaagtcccatgaagtgatc
aagttcatggatgtctaccagcgaagctactgccgtccgattgagaccctggtggacatc
ttccaggagtaccccgacgagatagagtacatcttcaagccgtcctgtgtgccgctgatg
cgctgtgcaggctgctgtaacgatgaagccctggagtgcgtgcccacgtcagagagcaac
atcaccatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcacagcagatgtgaatgcagaccaaagaaagacagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system