KEGG   Mus musculus (mouse): 22350Help
Entry
22350             CDS       T01002                                 

Gene name
Ezr, AW146364, R75297, Vil2, p81
Definition
(RefSeq) ezrin
  KO
K08007  
villin 2 (ezrin)
Organism
mmu  Mus musculus (mouse)
Pathway
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Gastric acid secretion
Proteoglycans in cancer
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    22350 (Ezr)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    22350 (Ezr)
  Digestive system
   04971 Gastric acid secretion
    22350 (Ezr)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    22350 (Ezr)
   05205 Proteoglycans in cancer
    22350 (Ezr)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     22350 (Ezr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22350 (Ezr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 A1
AA seq 586 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKLSRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMLRLQDYEQKTKR
AEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRAKEELERQAQDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKRITEAEKNERVQRQLLTLSNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagccaatcaacgtccgggtgaccaccatggatgccgagctggagtttgccatc
cagccaaacaccaccgggaagcagctctttgatcaggtggtaaagacgattggcctccgg
gaagtgtggtacttcggcctccagtatgtagacaataaaggatttcctacctggctgaaa
cttgataaaaaggtctccgcacaggaggtccgaaaggagaaccctgtccagtttaaattc
cgggccaagttctaccccgaagacgtggccgaggaactcatccaggacatcacacagaag
ctcttcttcctgcaagtcaaggacgggatcctcagcgacgagatctactgccccccagag
acagccgtgctcctgggctcctatgccgttcaggccaagttcggagattataacaaggaa
atgcacaagtctgggtacctcagctcggagcggctgatcccccagagagtcatggaccaa
cacaagctcagcagggaccagtgggaggaccggatccaggtgtggcacgcggaacaccga
gggatgctcaaggacagtgctatgctagaatacctgaagattgcccaggacctggaaatg
tatgggatcaactatttcgagatcaaaaacaagaaaggaacagacctttggcttggagtc
gatgcccttggacttaacatttatgagaaagatgacaagttgaccccaaagatcggcttc
ccttggagtgagatcaggaacatctctttcaacgacaagaagtttgtcattaagcccatc
gacaagaaggcacctgactttgtgttctacgccccgcgcctgagaattaacaagcggatc
ctgcagctctgcatggggaaccatgagctgtacatgcgccgcaggaagcccgacaccatc
gaggtgcagcagatgaaggcccaggctcgggaggagaagcaccagaagcagctagagcga
cagcagttggaaaccgagaagaagaggcgagagacggtggagagagaaaaggagcagatg
ctccgggagaaggaggagctgatgcttcggctgcaggactacgagcagaagaccaagagg
gcggagaaagagctctccgagcagattgagaaggccctccaactggaggaagagaggagg
cgagcccaggaggaggctgaacgtctggaggccgaccgcatggccgccctgcgggccaag
gaagaactcgagagacaggcgcaggatcagataaagagccaggagcagctggctgcagag
ctggcagagtacacggccaagatcgcactgctggaggaggcgcggaggcgcaaggaggac
gaggtagaagagtggcagcaccgggctaaagaagcccaggacgacctggtgaagaccaaa
gaggagctgcacctggtgatgacggccccaccgcccccaccgcccccagtgtatgagcct
gtgaattaccacgtgcaggagggactgcaggacgagggagcagagcctatgggctacagt
gccgagctctccagtgagggcatcctggatgaccgcaacgaggagaagcggatcacagag
gcagagaagaatgagcgcgtgcagcggcagctgctgaccctgagcaatgagttgtcccag
gcccgggatgagaacaagaggacccacaatgacatcatccacaacgagaacatgcggcaa
ggcagggacaagtataagacgctgcggcaaatcaggcagggcaacaccaagcaacgcatt
gacgagttcgaggccatgtag

DBGET integrated database retrieval system