KEGG   Mus musculus (mouse): 22352Help
Entry
22352             CDS       T01002                                 

Gene name
Vim
Definition
(RefSeq) vimentin
  KO
K07606  
vimentin
Organism
mmu  Mus musculus (mouse)
Pathway
Epstein-Barr virus infection
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    22352 (Vim)
  Infectious diseases
   05169 Epstein-Barr virus infection
    22352 (Vim)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     22352 (Vim)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     22352 (Vim)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22352 (Vim)
  Exosomal proteins of other cancer cells
   22352 (Vim)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 10.04 cM; 2 A2
AA seq 466 aa AA seqDB search
MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGA
YVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDK
VRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAE
DIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDE
EIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
AANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQD
TIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPTFSS
LNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaggtctgtgtcctcgtcctcctaccgcaggatgttcggtggctccggcaca
tcgagccggcccagctccaaccggagctatgtgaccacgtccacacgcacctacagtctg
ggcagcgcactgcgccccagcactagccgcagcctctattcctcatcccccggtggcgcc
tatgtgacccggtcctcggcagtgcgcctgcggagcagcgtgccgggcgtgcggctgctt
caagactcggtggacttctcgctggccgacgccatcaacactgagttcaagaacacccgc
accaacgagaaggtagaactgcaggagctgaatgaccgctttgccaactacatcgacaag
gtgcgcttcctcgagcagcagaacaaaatcctgctggctgagctcgagcagctcaagggc
cagggcaagtcgcgcctgggcgacctgtacgaggaggagatgcgggagctgcgccggcag
gtggatcagctcaccaacgacaaggcccgtgtcgaggtggagcgggacaacctggccgag
gacatcatgcggctgcgagagaaattgcaggaggagatgctccagagagaggaagccgaa
agcaccctgcagtcattcagacaggatgttgacaatgcttctctggcacgtcttgacctt
gaacggaaagtggaatccttgcaggaagaaattgcctttttgaagaaactgcacgatgaa
gagatccaggagctgcaggcccagattcaggaacagcatgtccagatcgatgtggacgtt
tccaagcctgacctcactgctgccctgcgtgatgtgcgccagcagtatgaaagcgtggct
gccaagaacctccaggaggccgaggaatggtacaagtccaagtttgctgacctctctgag
gctgccaaccggaacaacgatgccctgcgccaggccaagcaggagtcaaacgagtaccgg
agacaggtgcagtcactcacctgtgaagtggatgcccttaaaggcactaacgagtccctg
gagcgccagatgcgtgagatggaagagaattttgcccttgaagctgctaactaccaggac
actattggccgcctgcaggatgagatccaaaacatgaaggaagagatggctcgtcacctt
cgtgaataccaagatctgctcaatgttaagatggccctggacattgagatcgccacctac
aggaagctgctggaaggcgaggagagcaggatttctctgcctctgccaaccttttcttcc
ctgaacctgagagaaactaacctggagtcacttcctctggttgacacccactcaaaaaga
acactcctgattaagacggttgagaccagagatggacaggtgatcaatgagacttctcag
catcacgatgaccttgaataa

DBGET integrated database retrieval system