KEGG   Mus musculus (mouse): 22352Help
Entry
22352             CDS       T01002                                 

Gene name
Vim
Definition
(RefSeq) vimentin
  KO
K07606  vimentin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05169  Epstein-Barr virus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    22352 (Vim)
  Infectious diseases
   05169 Epstein-Barr virus infection
    22352 (Vim)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     22352 (Vim)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     22352 (Vim)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22352 (Vim)
  Exosomal proteins of other cancer cells
   22352 (Vim)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head Reo_sigmaC DUF1664 DUF4515 TPR_MLP1_2 Golgin_A5 Jnk-SapK_ap_N DUF573 Laminin_II MdcG GAS
Motif
Other DBs
NCBI-GeneID: 22352
NCBI-ProteinID: NP_035831
MGI: 98932
Ensembl: ENSMUSG00000026728
Vega: OTTMUSG00000011231
UniProt: P20152 Q5FWJ3
Position
2 A1; 2 10.04 cM
AA seq 466 aa AA seqDB search
MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGA
YVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDK
VRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAE
DIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDE
EIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
AANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQD
TIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPTFSS
LNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaggtctgtgtcctcgtcctcctaccgcaggatgttcggtggctccggcaca
tcgagccggcccagctccaaccggagctatgtgaccacgtccacacgcacctacagtctg
ggcagcgcactgcgccccagcactagccgcagcctctattcctcatcccccggtggcgcc
tatgtgacccggtcctcggcagtgcgcctgcggagcagcgtgccgggcgtgcggctgctt
caagactcggtggacttctcgctggccgacgccatcaacactgagttcaagaacacccgc
accaacgagaaggtagaactgcaggagctgaatgaccgctttgccaactacatcgacaag
gtgcgcttcctcgagcagcagaacaaaatcctgctggctgagctcgagcagctcaagggc
cagggcaagtcgcgcctgggcgacctgtacgaggaggagatgcgggagctgcgccggcag
gtggatcagctcaccaacgacaaggcccgtgtcgaggtggagcgggacaacctggccgag
gacatcatgcggctgcgagagaaattgcaggaggagatgctccagagagaggaagccgaa
agcaccctgcagtcattcagacaggatgttgacaatgcttctctggcacgtcttgacctt
gaacggaaagtggaatccttgcaggaagaaattgcctttttgaagaaactgcacgatgaa
gagatccaggagctgcaggcccagattcaggaacagcatgtccagatcgatgtggacgtt
tccaagcctgacctcactgctgccctgcgtgatgtgcgccagcagtatgaaagcgtggct
gccaagaacctccaggaggccgaggaatggtacaagtccaagtttgctgacctctctgag
gctgccaaccggaacaacgatgccctgcgccaggccaagcaggagtcaaacgagtaccgg
agacaggtgcagtcactcacctgtgaagtggatgcccttaaaggcactaacgagtccctg
gagcgccagatgcgtgagatggaagagaattttgcccttgaagctgctaactaccaggac
actattggccgcctgcaggatgagatccaaaacatgaaggaagagatggctcgtcacctt
cgtgaataccaagatctgctcaatgttaagatggccctggacattgagatcgccacctac
aggaagctgctggaaggcgaggagagcaggatttctctgcctctgccaaccttttcttcc
ctgaacctgagagaaactaacctggagtcacttcctctggttgacacccactcaaaaaga
acactcctgattaagacggttgagaccagagatggacaggtgatcaatgagacttctcag
catcacgatgaccttgaataa

DBGET integrated database retrieval system