KEGG   Mus musculus (mouse): 223775Help
Entry
223775            CDS       T01002                                 

Gene name
Pim3, BC026639, Kid1
Definition
(RefSeq) proviral integration site 3
  KO
K08807  
proto-oncogene serine/threonine-protein kinase Pim-3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     223775 (Pim3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   223775 (Pim3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15; 15 E3
AA seq 326 aa AA seqDB search
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKVYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGVAVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDL
RSGELKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPWMLGTEGSV
PENCDLRLCALDTDDGASTTSSSESL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtccaagttcggctccctggcgcacctctgcgggcctggcggcgtggaccac
ctcccagtgaagatcctacagccagccaaggctgacaaggagagcttcgagaaggtgtac
caggtgggcgccgtgctgggcagcggcggcttcggcacggtctacgcgggcagccgcatc
gccgacggactcccggtggctgtgaagcacgtggtgaaggagcgggtgaccgagtggggc
agtctcggcggagtggccgtgcccctggaggtggtgctgctgcgcaaggtgggcgcggcg
ggcggcgcgcgcggcgtcatccgcttgctggactggttcgagcggcccgacggcttcttg
ttggtgctggagcgacccgagccggcacaggacctcttcgacttcatcactgaacgaggc
gccctggacgagccgctggcgcgtcgcttcttcgcgcaggtgcttgccgctgtgcggcac
tgccacaattgtggggtcgtgcaccgcgacatcaaggacgagaacctgctggtggacctg
cgctcgggagagctgaagctcatcgacttcggctcgggcgcggtgctcaaggacacggtc
tacactgactttgatggcacccgtgtgtacagccccccagagtggatccgatatcaccga
tatcacgggcggtctgccactgtgtggtctctgggtgtactgctctacgacatggtgtgt
ggggacattccctttgagcaggatgaggagatcttgcgcggcaggctctttttccggagg
agggtctccccagagtgccagcagcttattgagtggtgtctctccctgaggccctcagag
aggccctccctggaccaaattgctgcccacccctggatgctggggacagaggggagcgtt
ccagagaactgtgaccttcggctttgtgccctggatactgacgacggagccagtaccact
tccagcagtgagagcttgtga

DBGET integrated database retrieval system