KEGG   Mus musculus (mouse): 224105Help
Entry
224105            CDS       T01002                                 

Gene name
Pak2, 5330420P17Rik, A130002K10Rik, AI836325, D16Ertd269e, PAK-2, mKIAA4182
Definition
p21 protein (Cdc42/Rac)-activated kinase 2 (EC:2.7.11.1)
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mmu04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mmu04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mmu04660]
Organismal Systems; Development; Axon guidance [PATH:mmu04360]
Human Diseases; Cancers; Renal cell carcinoma [PATH:mmu05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B2; 16 22.4 cM
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagagctagaagacaagcccccagcacctccagttcggatgagcagt
accatttttagcaccggaggaaaagatcctttatcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaaacccaggaacaaaatcatctccatattctctggcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctcccccatctgatttt
gagcacaccatccatgttggctttgatgctgttacgggagagttcactggcatgccagaa
cagtgggcgcggctgttgcagacctccaacattaccaaactcgagcagaagaagaaccct
caggcagtgctggatgtcttgaagttctacgactccaacactgtgaaacagaagtacctg
agtttcactcctcctgagaaagatggcttcccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtagtgacagaggaagatgatgatgatgaagacgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatttacacacggtctgtcatcgac
cccattcctgctccagttggtgattctaatgttgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggggacccaaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttct
ggaacagtttttactgccactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaagag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtacctcgctggtgggtccctcactgatgttgtaacagaaacctgcatg
gacgaagcgcagattgccgccgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaacttactgacttcggcttctgtgcccagatcactcctgaacagagcaaacgc
agtactatggttggaacaccgtactggatggcaccagaggtggtgacacggaaagcctat
ggtcccaaagttgacatatggtctctgggcatcatggctatcgagatggttgaaggagag
cctccatacctcaacgaaaatcctctgcgggcattatacctgatagctacaaatggaact
cctgaacttcagaatccagaaaaactttccccaatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaaaaggggttcggccaaggaactgttacagcatcctttcctg
aaactggccaaaccattgtctagcttgacgccactgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

DBGET integrated database retrieval system