KEGG   Mus musculus (mouse): 224762Help
Entry
224762            CDS       T01002                                 

Gene name
Trim31, BC026666, HCG1, HCGI, RNF
Definition
(RefSeq) tripartite motif-containing 31
  KO
K12011  
tripartite motif-containing protein 31 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     224762 (Trim31)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    224762 (Trim31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 B1
AA seq 507 aa AA seqDB search
MAGQPLACQLQEEVTCPICMEILQDPVTIDCGHNFCLQCISQVGKTSEKIQCPLCKLSVN
KNTFRPNKLLASLAEKIQSMDPADIQAEKEDSRCQRHKEKLHYFCEQDGAFLCVVCRDSK
DHKSHNVTLIDEAAQNYKVQIESQAQDLGQKDKKIIEEKKQGEGAIWAFRAQVDLEKLKI
HEEFKLLRQRLDEEESFLLSRLDWLEQQGAKQLRQYVTVTEKQLNSLRKLTKSLKIRLQS
SSMELLKDIKDALSRGKEFQFLNPNPVPEDLEKKCSEAKARHESIIKTLTELKDDMNAEG
KRDKSAFMNSLNKEEKESWSLLQKNNSVLPTSVPVTLDKSSADPDLTFSQDLKKVTLYIV
AGKASNRQAKPRPFYPFHCVRGSPGLSSGRQVWEAEIRGPSGGACIVGVVTELARGAQSQ
TVSAQSYIWALRISPSGCQPFTNCKAQEYLQVCLKKVGVYVNHDCGEVVFYDAITSKHIY
TFQTSFDGKVFPLFGLQVACSHITLSP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcaggccaacctctggcctgccaactgcaggaggaggtgacctgccccatctgcatg
gaaattctacaagatcctgtcaccattgactgtgggcacaacttctgcctgcagtgtatc
agtcaggttggaaaaacgtcagaaaagatccaatgtcctctctgcaaactctctgtgaat
aagaatacgttcaggcccaataagctgctggctagtcttgcagagaagatccaaagtatg
gatcctgctgacatccaagcagaaaaggaagactcaagatgtcagaggcacaaggaaaag
ctacattacttctgcgagcaggatggggcattcctctgtgtggtgtgtcgtgactccaag
gaccacaagtctcacaatgtcaccttgatagatgaggctgcccagaactacaaggtgcag
attgagtcacaggcccaagatttggggcaaaaggacaagaaaataattgaagagaaaaaa
caaggtgaaggggcaatctgggcgttcagggcccaggtggatctagagaaactaaagatc
catgaggaattcaagctcctgcgccagagactagatgaggaagagagtttcctcctgtcc
aggctggactggctggagcagcagggagccaagcagttgagacaatatgtcactgtgaca
gagaagcagctgaactctctaaggaagctcactaaatccttgaaaataaggctgcaatca
tcatccatggagctactaaaggacattaaagacgccttgagcaggggtaaggaatttcag
tttctcaacccaaacccagttcctgaggacctggagaaaaaatgcagtgaagcaaaagca
aggcatgagtccatcataaaaaccctgacagaactcaaagacgatatgaatgccgaaggg
aagagagataaaagcgcattcatgaacagcctgaataaagaagaaaaggagagctggagc
ctgttacagaagaataattcagtgttgcccacctcagtccctgtgaccctggacaagtcc
tcagctgacccagacctcaccttttctcaggatctaaagaaagtgaccttgtatattgta
gctggaaaagcttccaataggcaggcaaaacctcgaccattctaccctttccactgtgtg
aggggttccccaggcctctcctcaggccgccaggtgtgggaggcagaaatccgggggccc
tcaggtggggcatgcattgtgggcgtggttacagagttggcgcgaggggcccagagtcaa
accgtgagcgcgcagagctacatatgggcactgcggatctcgccctctggatgccagcca
ttcaccaattgtaaagcccaggagtacctccaggtctgtcttaagaaagtgggtgtctat
gtgaatcatgactgtggagaggtcgtcttctatgatgccatcactagcaaacacatctat
actttccaaacttcctttgacgggaaggtcttcccccttttcgggctccaagttgcctgc
agccatatcaccctgagcccttag

DBGET integrated database retrieval system