KEGG   Mus musculus (mouse): 224836Help
Entry
224836            CDS       T01002                                 

Gene name
Usp49, C330046L10Rik, Gm545
Definition
ubiquitin specific peptidase 49 (EC:3.4.19.12)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     224836 (Usp49)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   224836 (Usp49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
17 C; 17
AA seq 685 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCLQCATTESAWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDLLARRGRTLRST
AAGEDVVPPQRTPQGQPQMLTALWYRRQRLLAKTLRLWFQKSSRGRAQLEQRRQEEALER
KKEAARQRRREVKRRLLEELASAPPRKSARLLLHAPGPVAVRPATLATSRRLSAAALNPR
RQPAVAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSTSEHLFPQATNGKAQL
SGRPASSSAAELSVRSVRAQGCEPQGLCWSSGASISRSLELIQNKEPSSKHISLCHELHT
LFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGSTRR
ILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYHCIE
KGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIY
RLPQVLRLHLKRFRWSGRNHREKIGVHVIFDQVLTMEPYCCRDMLSSLDKETFAYDLSAV
VMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFYTRRTVQGSA
KLSEPHLQAQVHSSSKDERRTYTLP
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttacggctcgcccaggaccactccatcctgaat
ccccagaagtggtgctgtctgcagtgcgccaccaccgagtctgcgtgggcctgcctcaag
tgctcccacgtggcctgcggccgctacattgaagaccatgcactaaaacactttgaagag
acaggacacccgctggccatggaggtccgggacctctacgtgttctgctacctgtgcaag
gactacgtgctcaatgacaacccggagggggacctgaagttgctgagaagctccctcctg
gcagttcgaggccagaagcaggacctgctcgccaggcgtgggcggacgctgcggtccaca
gctgcgggcgaggacgtggtcccgccacagcgcactcctcagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgcctgctggccaagacgctgcggctctggttccag
aagagctcccgcggccgggcgcagctggagcagcggcggcaggaggaggcgctggagcgc
aagaaggaggcggcgcggcagcggcgccgcgaggtcaagcggcggctgctggaggagctg
gccagtgcgccgccgcggaagagtgcgcgcctgctcctgcacgctcccgggcccgtggcc
gtgcgccctgccaccctcgctacctcccggcgcttgtccgcagctgccctcaatccgcgc
cgccagccggcggtggccccaggtgtcaccggcctgcgcaacctggggaatacctgctac
atgaactccatcctccaagtgctcagccacctccagaagttccgggaatgtttcctgaac
ctcgacccttccacctccgagcacctgtttccccaagcaaccaacgggaaggcgcagctc
tctggtaggccagccagcagctctgccgcagagttgtcagtaaggagtgtccgggcccag
ggctgcgaacctcagggcctctgctggagcagcggagcctccatcagcaggagcctggag
ctcattcagaacaaggaacccagctcaaagcacatttccctctgccacgaactgcacacc
ctcttccgagtcatgtggtctgggaagtgggcgctggtatcaccctttgccatgcttcac
tccgtgtggagcctgattcccgccttccgtggctacgaccagcaggatgcgcaggaattt
ctctgcgaactgctgcacaaggtgcagcaggaacttgagtctgagggttccacacgcagg
atcctcatcccattctcccagaggaagctcaccaaacaggtcttaaaggtggtgaacacc
atatttcatgggcagctgctcagtcaggtcacatgtatatcatgcaattataaatccaat
accattgagcccttttgggatctgtccctggaattccctgaacgataccactgcatagaa
aaggggtttgtccctttgaatcagacagagtgcctgctcactgagatgctagccaagttc
accgagacagaggccctggaggggagaatctacgcttgtgaccagtgtaacagcaaacga
cgaaagtccaaccccaaaccccttgttctgagtgaagctaggaagcagttaatgatctac
agactacctcaggtcctccggctacaccttaaaagattcaggtggtctggccgtaaccat
cgtgagaagattggggtccatgtcatctttgaccaggtattaaccatggaaccttactgc
tgcagggacatgctctcctctcttgacaaagagacctttgcctatgatctctccgcagtg
gtcatgcatcacgggaaagggtttggctcaggacactacacagcctattgctacaacaca
gagggaggtttttgggtccactgcaatgactcaaagctggatgtatgcagtgtcgaggaa
gtgtgcaaaacccaggcctacattcttttttacactcgaagaacagttcagggcagcgca
aaactctcagaaccccatctccaagctcaggtgcactccagcagcaaggacgaacgcaga
acatacacattgccctga

DBGET integrated database retrieval system