KEGG   Mus musculus (mouse): 224897Help
Entry
224897            CDS       T01002                                 

Gene name
Dpp9, 6430584G11Rik, A330078I11, DPP_IX, DPRP2
Definition
(RefSeq) dipeptidylpeptidase 9 (EC:3.4.14.5)
  KO
K08656  
dipeptidyl-peptidase 9 [EC:3.4.14.5]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     224897 (Dpp9)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   224897 (Dpp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17; 17 D
AA seq 862 aa AA seqDB search
MCSGVSPVEQVAAGDMDDTAARFCVQKHSWDGLRSIIHGSRKSSGLIVSKAPHDFQFVQK
PDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGVY
SREEELLRERKRLGVFGITSYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIK
TQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTFCHQGSAGVLDNPKSAGV
ATFVIQEEFDRFTGCWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPALEERKTD
SYRYPRTGSKNPKIALKLAELQTDHQGKIVSSCEKELVQPFSSLFPKVEYIARAGWTRDG
KYAWAMFLDRPQQRLQLVLLPPALFIPAVESEAQRQAAARAVPKNVQPFVIYEEVTNVWI
NVHDIFHPFPQAEGQQDFCFLRANECKTGFCHLYRVTVELKTKDYDWTEPLSPTEDEFKC
PIKEEVALTSGEWEVLSRHGSKIWVNEQTKLVYFQGTKDTPLEHHLYVVSYESAGEIVRL
TTLGFSHSCSMSQSFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAANC
PPDYVPPEIFHFHTRADVQLYGMIYKPHTLQPGRKHPTVLFVYGGPQVQLVNNSFKGIKY
LRLNTLASLGYAVVVIDGRGSCQRGLHFEGALKNQMGQVEIEDQVEGLQYVAEKYGFIDL
SRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQQGY
EAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHS
IRCRESGEHYEVTLLHFLQEHL
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcggggtctccccagttgagcaggtggccgcaggggacatggatgacacggca
gcacgcttctgtgtgcagaagcactcgtgggatgggctgcgtagcattatccacggcagt
cgcaagtcctcgggcctcattgtcagcaaggccccccacgacttccagtttgtgcagaag
cctgacgagtctggcccccactctcaccgtctctattacctcggaatgccttacggcagc
cgtgagaactccctcctctactccgagatccccaagaaagtgcggaaggaggccctgctg
ctgctgtcctggaagcagatgctggaccacttccaggccacaccccaccatggtgtctac
tcccgagaggaggagctactgcgggagcgcaagcgcctgggcgtcttcggaatcacctct
tatgacttccacagtgagagcggcctcttcctcttccaggccagcaatagcctgttccac
tgcagggatggtggcaagaatggctttatggtgtccccgatgaagccactggagatcaag
actcagtgttctgggccacgcatggaccccaaaatctgccccgcagaccctgccttcttt
tccttcatcaacaacagtgatctgtgggtggcaaacatcgagactggggaggaacggcgg
ctcaccttctgtcaccagggttcagctggtgtcctggacaatcccaaatcagcaggcgtg
gccacctttgtcatccaggaggagttcgaccgcttcactgggtgctggtggtgccccacg
gcctcttgggaaggctccgaaggtctcaagacgctgcgcatcctatatgaggaagtggac
gagtctgaagtggaggtcattcatgtgccctcccccgccctggaggagaggaagacggac
tcctaccgctaccccaggacaggcagcaagaaccccaagattgccctgaagctggctgag
ctccagacggaccatcagggcaaaatcgtgtcaagctgcgagaaggaactggtacagcca
ttcagctcccttttccccaaagtggagtacatcgcccgggctggctggacacgggacggc
aaatatgcctgggccatgttcctggaccgtccccagcaacggcttcagcttgtcctcctg
ccccctgctctcttcatcccggccgttgagagtgaggcccagcggcaggcagctgccaga
gccgtccccaagaatgtgcagccctttgtcatctatgaagaagtcaccaatgtctggatc
aacgtccacgacatcttccacccgtttcctcaggctgagggccagcaggacttttgtttc
cttcgtgccaacgaatgcaagactggcttctgccacctgtacagggtcacagtggaactt
aaaaccaaggactatgactggacggaacccctcagccctacagaagatgagtttaagtgc
cccatcaaggaggaggtcgccctgaccagtggcgagtgggaggtcttgtcgaggcatggc
tccaagatctgggtcaacgagcagacgaagctggtgtactttcaaggtacaaaggacaca
ccgctggaacatcacctctatgtggtcagctacgagtcagcaggcgagatcgtgcggctc
accacgctcggcttctcccacagctgctccatgagccagagcttcgacatgttcgtgagt
cactacagcagtgtgagcacgccaccctgtgtacatgtgtacaagctgagcggccccgat
gatgacccactgcacaagcaaccacgcttctgggccagcatgatggaggcagccaattgc
cccccagactatgtgccccctgagatcttccacttccacacccgtgcagacgtgcagctc
tacggcatgatctacaagccacacaccctgcaacctgggaggaagcaccccactgtgctc
tttgtctatgggggcccacaggtgcagttggtgaacaactcctttaagggcatcaaatac
ctgcggctaaatacactggcatccttgggctatgctgtggtggtgatcgatggtcggggc
tcctgtcagcggggcctgcacttcgagggggccctgaaaaatcaaatgggccaggtggag
attgaggaccaggtggaaggcttgcagtacgtggctgagaagtatggcttcattgacttg
agccgagtcgccatccatggctggtcctacggcggcttcctctcactcatggggctcatc
cacaagccacaagtgttcaaggtagccattgcgggcgctcctgtcactgtgtggatggcc
tatgacacagggtacacggaacgatacatggatgtccccgaaaataaccagcaaggctat
gaggcagggtctgtagccctgcatgtggagaagctgcccaatgagcctaaccgcctgctt
atcctccacggcttcctggacgagaacgttcacttcttccacacaaatttcctggtgtcc
cagctgatccgagcaggaaagccataccagcttcagatctacccaaacgagagacatagc
atccgctgccgcgagtccggagagcattacgaggtgacgctgctgcactttctgcaggaa
cacctgtga

DBGET integrated database retrieval system