KEGG   Mus musculus (mouse): 225326Help
Entry
225326            CDS       T01002                                 

Gene name
Pik3c3, 5330434F23Rik, Vps34
Definition
(RefSeq) phosphoinositide-3-kinase, class 3 (EC:2.7.1.137)
  KO
K00914  
phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Regulation of autophagy
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    225326 (Pik3c3)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    225326 (Pik3c3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    225326 (Pik3c3)
   04140 Regulation of autophagy
    225326 (Pik3c3)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    225326 (Pik3c3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     225326 (Pik3c3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Macropinocytosis
   Kinases
    225326 (Pik3c3)
  Rab GTPases and associated proteins
   Rab associated proteins
    225326 (Pik3c3)
 Endosome - Lysosome transport
    225326 (Pik3c3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 18 B1
AA seq 887 aa AA seqDB search
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggcggagaagttccactacatctacagctgtgacctggacatcaacgtgcag
ctgaagatagggagcttggaagggaagagagaacaaaagagctataaagctgtcctagaa
gatcccatgttaaagttttctgggctataccaagagacatgctccgacctctatgtgact
tgtcaagtgtttgctgaagggaagcccctggccttaccagtcagaacatcctacaaggcg
tttagtacaagatggaattggaacgagtggctgaaacttccggtgaagtaccctgacctg
cccaggaatgcccaagtggccttgactatatgggatgtgtatggaccgggaagcgctgtg
ccagtgggaggaacaaccgtgtcgctctttggaaaatatggcatgtttcgccaaggaatg
catgacttgaaggtctggcctaacgtggaggcagatggttctgaacctacaagaactccc
ggcagaacaagcagcacactgtcagaagatcagatgagccgcctcgccaagctcaccaag
gctcatcggcaaggacacatggtgaaagtggattggctggacagattaacatttagagag
atagaaatgataaatgagagtgagaaacgaagctctaatttcatgtacttgatggttgag
tttcgctgtgtcaagtgcgatgacaaggagtatggcattgtttactatgaaaaggatggt
gacgaatcatctccaattttaaccagttttgagttagtgaaagttcctgatcctcaaatg
tctatggagaatttagtggagagcaaacaccacaagcttgctcggagcttaagaagcggg
ccatctgaccacgatctcaaacccaacgctaccacaagagatcagctaaatattattgtg
agttacccaccaaccaagcaactcacatatgaagaacaagatcttgtttggaaatttaga
tattatcttactaatcaagaaaaagctctgacgaagttcttgaagtgtgttaattgggac
ctgccccaggaggccaagcaggccctggaacttctgggaaagtggaagccaatggatgta
gaggactccctggagctgctctcctctcattacaccaaccccaccgtgaggcgctacgct
gtggcccgcctgaggcaggccgatgatgaggatttgctgatgtacttactgcagctggtc
caggctctgaaatatgaaaactttgatgacataaagaatggtttggaacctaccaagaaa
gatagtcaaacttcagcatcagaaagtctgtcaaattctggagtcagttctggagacata
gatagctcccaaattataaccaaccctcttcctcccgtggcctcccctcctcctgcatct
aaagcaaaggaagtttccgatggggaaaatctcgagcaagatctatgtacgttcttgata
tcaagagcctgtaagaactcaacactggctaattatttatactggtatgtgatagtggag
tgtgaagatcaggacacccagcagcgggacccaaagactcacgagatgtacctgaacgtg
atgaggcgcttcagccaagccttgctcaagggtgacaagtctgtgagagtcatgcgctcc
ctgctggcggctcagcagacctttgtagatcgcctggtccatctgatgaaggcggtgcag
agagaaagtgggaaccgcaagaagaagaatgagagacttcaggccttgcttggagataat
gagaaaatgaacttatcagatgtggaactgatcccattgccgctggagccacaggtgaaa
ataaggggcatcatcccggaaacagctaccctgttcaagagtgctcttatgcctgcccag
ctgttcttcaagactgaagatggaggcaaatacccagttattttcaagcatggagacgac
ttgcgtcaagatcagcttattcttcagatcatctccctcatggacaagctgttacggaaa
gaaaacctggatttgaaattgaccccatacaaggtgttagccactagcacaaaacatggc
ttcatgcagttcatccagtcggttcctgtcgcagaagttcttgacacagagggaagcatt
cagaactttttcaggaaatatgcccccagtgagactggaccctatggcatcagtgcagag
gtcatggacacttacgttaaaagctgtgctggatactgtgtgattacgtacattcttgga
gttggagaccggcacctggataaccttttgttaacaaagacaggcaaactcttccatata
gatttcgggtatattttgggtcgagatccgaagcccctccctcctccgatgaagctgaac
aaggagatggtggaagggatgggtggcacccagagtgagcagtaccaagagttccgaaag
cagtgctacacagccttcctccacctgcgaaggtattccaatctgatcttgaacttgttc
tccttgatggttgatgcaaacattccagatattgctcttgaaccagataaaactgtaaaa
aaggttcaggataagttccgcctggacctgtcagatgaggaggctgtgcactacatgcag
agtctgatcgacgagagcgtccacgcactgttcgccgccgtggtggagcagatccataag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system