KEGG   Mus musculus (mouse): 225724Help
Entry
225724            CDS       T01002                                 

Gene name
Mapk4, A330097D03Rik, Erk3, Prkm4, p63Mapk
Definition
mitogen-activated protein kinase 4 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     225724 (Mapk4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   225724 (Mapk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 E2; 18
AA seq 583 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFIDFQPLGFGVNGLVLSATDSRACRKVAVKKIVLSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGT
LTEDHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGKMLFAGAHELEQMQL
ILDTIPVVREEDKEELLRVMPSFVSSTWEVKRPLRKLLPDVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAASQSQLSNWDRYPVSLSSD
LEWRPDRCQDASEVQRDPRAGSTPLAEDVQVDPRKDSQSSSERFLEQSHSSMERAFEADY
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAASAPPRAAVAADPVSRED
EPASLFLEIAQWVKSTQSGSERASPPPDAPEPRLSASPPGHPTPIDGGASPQFDLDVFIS
RALKLCTKPEDLPENKLGDLNGACISEHPGDLVQTEAFSKERW
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaaggtgactgcatcgccagcgtctacgggtatgaccttggtgggcgcttc
attgacttccaaccccttggctttggggtcaacgggctggtgctgtcagctacggacagc
agggcttgccggaaggtggccgtgaagaagatcgttctgagtgacgcccgcagcatgaag
cacgcgctccgagagatcaaaatcatccggcgcctggaccacgacaacattgtcaaggtg
tacgaggtgctgggacccaaggggagcgatctgcagggcgagctcttcaagtttagcgtg
gcctatatcgtccaagagtacatggagactgacctggcgtgcctgctggagcagggcacg
ctgactgaggaccacgccaagctgttcatgtatcagctgctccgtgggctcaagtacatc
cactctgcgaacgtgctgcacagagacctgaagcccgccaacatcttcatcagcacggag
gaccttgtgctcaagattggggatttcgggttggcaaggatcgtggatcaacattactca
cacaagggttatctgtcagaagggttggtgacaaagtggtaccggtctccgagactgctc
ctgtccccaaataactacacaaaagccatcgatatgtgggcagctggctgcatcctggca
gagatgctcacggggaaaatgctcttcgctggggctcacgagctggagcagatgcagctc
atcctagacaccatccctgtggtccgggaggaagacaaggaggagctgctcagggtgatg
ccgtccttcgtcagcagcacctgggaggtgaagaggccactgcgcaagctgctcccggac
gtcaacagtgaagccattgactttctggagaagatcctgacctttaaccccatggaccgc
ttaacagctgagatggggcttcagcatccttacatgagcccgtactcgtgccccgaggat
gagcccacctcacaacaccctttccgcattgaggacgagatcgacgacatcgtgctgatg
gctgccagtcagagccagctctccaactgggacaggtatcctgtgagcctgtcctcagat
ctggaatggcggcctgaccggtgccaggacgccagcgaggtgcagcgcgatccacgtgca
ggctctacaccgctggcggaggatgttcaggtggacccacgcaaggactcacagagcagc
tccgagcgcttcctggagcagtcacactcgtccatggagcgcgccttcgaggccgactat
ggacggtcctgcgactacaaagtggggtctccatcctacctggacaagctactgtggcgc
gacaacaagccccaccactactcggaacccaagctcatcctggacctgtcgcactggaag
caggcggccagcgctccccccagggctgcagtagcagcagaccctgtgtcacgtgaggat
gagccagcaagcctctttctggagattgcacagtgggtcaagagcacacaaagtggctct
gagcgtgccagtcctccccctgatgccccagagccccgtctctctgcctcacccccggga
cacccaacacccatcgatgggggtgccagtccccagttcgacttagacgtgttcatctcg
cgtgccctaaagctctgcaccaaacctgaggacctcccggaaaacaaactgggcgacctg
aatggcgcgtgcatctctgagcaccctggcgacctcgtgcagacagaggccttctccaaa
gaaaggtggtga

DBGET integrated database retrieval system