KEGG   Mus musculus (mouse): 225865Help
Entry
225865            CDS       T01002                                 

Gene name
Catsper1, Catsper, KSper
Definition
(RefSeq) cation channel, sperm associated 1
  KO
K16889  
cation channel sperm-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  CatSper and two-pore channel
   225865 (Catsper1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 686 aa AA seqDB search
MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQH
GGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGG
PQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADT
ISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHI
HHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASL
SEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIV
VCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDF
FIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAG
TLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSL
IYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVH
EKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQ
KFRSQAYVIDELVDMAFEAGDDDYGK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatcttcaaggagggacgagtcttaccatgagacacaccccggtagcttagac
ccaagccatcaatcccacccccacccccacccccaccccaccctgcataggccaaaccaa
ggtggcgtctattacgattctcctcagcatgggatgttccaacaaccataccaacagcat
ggtgggttccatcaacaaaatgaattgcagcatttgcgtgagttctcagactcccatgac
aatgctttctcccatcattcctatcagcaggacagggctggtgtctctaccttacctaat
aacatctctcacgcttatggtggatcgcacccccttgctgagtcccagcactctggtgga
ccccagagtggacctcgtattgacccgaatcatcatccccaccaagatgacccccataga
cccagtgaacctttgtcccacccctcctctactggcagccaccaagggacaacccatcaa
caataccatgagaggtctcaccatcttaacccccagcagaacagagatcatgcagacacc
atttcctatcgctccagtacgcggttctatcgctcccatgcgccgttcagtcgccaggaa
agacctcatctccacgctgatcaccatcatgagggccatcatgcccattctcaccatggt
gaacatccccaccacaaggagcaacggcactatcacggagatcatatgcatcaccatatc
catcatcgctccccaagtgcctcccaactctcacacaagtctcacagcacacttgccacc
tctccatctcatgtgggatcgaaaagcacagccagtggggctcggtacacctttggagct
cgctctcaaattttcggcaaagctcagtccagggagagcttgagagaatcagcctctttg
agtgaaggggaggatcacgttcagaaacgcaaaaaggcccagagggcccacaagaaggca
cacaccgggaatatcttccaattgctatgggaaaaaataagccatctccttttgggtctt
cagcaaatgatattgtcactgacccagtccctgggctttgagacctttatcttcatcgtg
gtctgcctcaacacagtcatccttgtggcccagactttcactgagctagagatccgaggt
gaatggtacttcatggtcttggactccatcttcctctccatctatgtactagaagcagtc
ctcaagctaattgccctgggcctggagtatttttatgacccatggaacaacctggacttc
ttcatcatggtcatggcagtgctggactttgtgctccttcagataaactcgctctcatat
tcattctacaaccacagcctgttccggattctcaaagtcttcaaaagtatgcgggccctg
agggccatccgggttcttcggaggctcagcatcctgaccagcctccacgaagtggccggg
actctgagtggatctttaccatccatcacggccatcctcaccctcatgtttacctgcctc
ttcctcttctctgtggttctccgagcactgtttcaggactcagaccccaagcgcttccag
aacatctttaccacactcttcaccctgttcaccatgctcaccctggacgactggtccctc
atctacatagacaacagggcccaaggcgcctggtacatcataccgatcctcatgatttac
attgtcatccagtacttcatcttcctcaacctggtgattgctgtcctggtagataacttc
cagatggcgttgctcaaaggcctagagaaagtgaagctggagcaagctgcccgggtccat
gagaagttgttggatgactctctgacagatctcaacaaagcagacgccaatgcacaaatg
accgaggaggccttgaagatgcagcttattgagggaatgtttggcaacatgacagtgaag
cagcgggtgctccacttccagttcctgcagttggtggcagcggtagaacagcatcaacag
aagtttcgttcccaagcgtacgtcatcgatgagcttgtggacatggcatttgaggctgga
gacgacgactacgggaagtga

DBGET integrated database retrieval system