KEGG   Mus musculus (mouse): 225887Help
Entry
225887            CDS       T01002                                 

Gene name
Ndufs8, BC021616, CI-23kD, TYKY
Definition
NADH dehydrogenase (ubiquinone) Fe-S protein 8 (EC:1.6.5.3 1.6.99.3)
Orthology
K03941  
NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    225887 (Ndufs8)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    225887 (Ndufs8)
   05012 Parkinson's disease
    225887 (Ndufs8)
   05016 Huntington's disease
    225887 (Ndufs8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    225887 (Ndufs8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     225887 (Ndufs8)
   1.6.99  With other, unknown, acceptors
    1.6.99.3  NADH dehydrogenase
     225887 (Ndufs8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19
AA seq 212 aa AA seqDB search
MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQESEVDMKSATDNAARI
LMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETH
EELLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcctgagctcatcaatgctgccacgggccttggcccaggccatgcgcacagga
catcttaatggacaaagccttcatagcagcgcagtggcggcaacgtacaagtatgtgaat
aagaaggaacaggagtctgaggtggacatgaagtccgcaactgacaatgcagctcggatt
ctgatgtggacagaactcatccgaggactgggcatgaccctaagttacctctttcgagag
cctgccaccatcaactacccctttgagaagggcccactgagtccgcgcttccgtggggag
catgcactgcgccgctacccatctggagaggagcgttgcattgcctgcaaactctgtgag
gccatctgtcctgcacaggccatcaccattgaggctgagccaagagccgatggcagccgc
cgaacgacacgctatgacatcgacatgaccaagtgtatctactgtggtttctgccaggaa
gcctgccctgttgatgccattgtggagggccccaacttcgagttctccaccgagacacac
gaggagttgctgtacaacaaggagaagctactcaacaatggagacaagtgggaggccgag
atcgctgccaacatccaggctgactacctgtaccggtga

DBGET integrated database retrieval system