KEGG   Mus musculus (mouse): 225887Help
Entry
225887            CDS       T01002                                 

Gene name
Ndufs8, BC021616, CI-23kD, TYKY
Definition
NADH dehydrogenase (ubiquinone) Fe-S protein 8 (EC:1.6.5.3 1.6.99.3)
Orthology
K03941  
NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mmu00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:mmu05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:mmu05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mmu05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mmu04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19
AA seq 212 aa AA seqDB search
MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQESEVDMKSATDNAARI
LMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETH
EELLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcctgagctcatcaatgctgccacgggccttggcccaggccatgcgcacagga
catcttaatggacaaagccttcatagcagcgcagtggcggcaacgtacaagtatgtgaat
aagaaggaacaggagtctgaggtggacatgaagtccgcaactgacaatgcagctcggatt
ctgatgtggacagaactcatccgaggactgggcatgaccctaagttacctctttcgagag
cctgccaccatcaactacccctttgagaagggcccactgagtccgcgcttccgtggggag
catgcactgcgccgctacccatctggagaggagcgttgcattgcctgcaaactctgtgag
gccatctgtcctgcacaggccatcaccattgaggctgagccaagagccgatggcagccgc
cgaacgacacgctatgacatcgacatgaccaagtgtatctactgtggtttctgccaggaa
gcctgccctgttgatgccattgtggagggccccaacttcgagttctccaccgagacacac
gaggagttgctgtacaacaaggagaagctactcaacaatggagacaagtgggaggccgag
atcgctgccaacatccaggctgactacctgtaccggtga

DBGET integrated database retrieval system