KEGG   Mus musculus (mouse): 22591Help
Entry
22591             CDS       T01002                                 

Gene name
Xpc
Definition
(RefSeq) xeroderma pigmentosum, complementation group C
  KO
K10838  
xeroderma pigmentosum group C-complementing protein
Organism
mmu  Mus musculus (mouse)
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    22591 (Xpc)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      22591 (Xpc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 D
AA seq 930 aa AA seqDB search
MAPKRTADGRRRKRGQKTEDNKVARHEESVADDFEDEKQKPRRKSSFPKVSQGKRKRGCS
DPGDPTNGAAKKKVAKATAKSKNLKVLKEEALSDGDDFRDSPADCKKAKKHPKSKVVDQG
TDEDDSEDDWEEVEELTEPVLDMGENSATSPSDMPVKAVEIEIETPQQAKERERSEKIKM
EFETYLRRMMKRFNKEVQENMHKVHLLCLLASGFYRNSICRQPDLLAIGLSIIPIRFTKV
PLQDRDAYYLSNLVKWFIGTFTVNADLSASEQDDLQTTLERRIAIYSARDNEELVHIFLL
ILRALQLLTRLVLSLQPIPLKSAVTKGRKSSKETSVEGPGGSSELSSNSPESHNKPTTSR
RIKEEETLSEGRGKATARGKRGTGTAGSRQRRKPSCSEGEEAEQKVQGRPHARKRRVAAK
VSYKEESESDGAGSGSDFEPSSGEGQHSSDEDCEPGPRKQKRASAPQRTKAGSKSASKTQ
RGSQCEPSSFPEASSSSSGCKRGKKVSSGAEEMADRKPAGVDQWLEVYCEPQAKWVCVDC
VHGVVGQPVACYKYATKPMTYVVGIDSDGWVRDVTQRYDPAWMTATRKCRVDAEWWAETL
RPYRSLLTEREKKEDQEFQAKHLDQPLPTSISTYKNHPLYALKRHLLKFQAIYPETAAVL
GYCRGEAVYSRDCVHTLHSRDTWLKQARVVRLGEVPYKMVKGFSNRARKARLSEPQLHDH
NDLGLYGHWQTEEYQPPIAVDGKVPRNEFGNVYLFLPSMMPVGCVQMTLPNLNRVARKLG
IDCVQAITGFDFHGGYCHPVTDGYIVCEEFRDVLLAAWENEQAIIEKKEKEKKEKRALGN
WKLLVRGLLIRERLKLRYGAKSEAAAPHAAGGGLSSDEEEGTSSQAEAARVLAASWPQNR
EDPEQKSEYTKMTRKRRAAEASHLFPFEKL
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaagcgcaccgcagacggaaggcggcggaagcggggccagaaaaccgaggac
aacaaagtagcccggcacgaggagagcgttgcggatgactttgaagatgagaagcagaaa
ccccgaaggaagagctctttcccgaaagtctctcaaggaaagaggaagaggggctgcagt
gatccaggggaccccacaaatggtgcagcaaaaaagaaagtggccaaagccactgctaaa
tccaagaatctcaaggttctgaaggaggaagcactcagcgacggggatgacttccgggac
tcaccagctgactgcaagaaggcaaagaaacacccaaaaagcaaggtggtggaccaaggc
actgatgaagatgacagtgaggatgactgggaggaggtggaagagcttactgaacctgtg
ctggacatgggagaaaattctgccacctcaccgtctgacatgcctgtgaaggcggtggag
attgaaattgaaacaccacagcaggcgaaagaacgggaaagaagtgagaagataaagatg
gagtttgagacatacctgcggaggatgatgaagcgtttcaataaagaagtacaggagaac
atgcacaaggttcacctgctgtgcctgctggccagtggcttctatcgaaatagcatctgc
cgacagccagatctgctggccattggcctctccatcattccaattcgctttaccaaggtg
ccacttcaagatagggatgcctactacctttcaaacctggtaaagtggttcatcggaacc
ttcactgtcaacgctgacctttcagccagcgagcaggacgacctgcagaccaccttggaa
aggaggattgccatttactctgcgagggataatgaagagttggtccatatatttcttctg
attcttcgggctctgcagctgctcacccggctggtcttgtctctgcagcccattccactg
aagtcagctgtgacaaaggggaggaaatcttccaaggagacatctgtagagggtcctgga
ggttcttcagaactctctagtaacagtccagaaagccacaacaaacctacgaccagcagg
agaatcaaagaagaagaaaccttgtctgagggcagaggcaaagcaaccgccagggggaag
agaggcacaggcactgcgggcagcaggcagcggaggaagccctcttgcagcgagggagag
gaggccgagcagaaagtccagggccgtccacatgcccggaagcggcgtgtggctgccaag
gtgtcatacaaagaggagagtgagagcgatggggcaggcagcggctctgactttgaaccg
tccagtggggagggccagcattcctctgatgaggattgtgagcctggccctcgcaagcag
aagagggcctcagctcctcagaggacaaaggctgggtctaagagtgcttccaagacccaa
cgcggaagccagtgtgagccgtcaagctttccggaggcgtcttcaagctcttcaggctgt
aagagaggcaagaaggtttccagtggtgctgaagagatggcagataggaaacctgctggt
gtagaccagtggctggaggtgtactgtgagccacaggcaaagtgggtgtgtgtggactgt
gtacatggtgtggtgggccagcctgtggcctgttacaaatatgccaccaaacccatgacc
tatgttgtaggcattgacagtgatggctgggtccgagatgttactcagaggtatgaccca
gcctggatgaccgcaacccgcaagtgccgggttgatgctgagtggtgggctgagaccttg
agaccctatcggagcctacttacggagagggagaagaaggaagaccaggagtttcaggcg
aagcacctggaccagcctttgcccacctccatcagcacatacaagaaccaccctctgtat
gccctgaagcgccacctcttgaaattccaggctatctaccctgagacagctgcggtgctc
gggtattgtcgtggagaagcagtctattccagggattgcgtgcataccttgcactccagg
gacacatggctgaagcaagcaagagtggtgcggcttggagaagtgccctataagatggtg
aaaggcttctctaaccgtgcccggaaagcccggctctcggagccccagctgcatgaccac
aacgacttgggcctctatggtcactggcagacggaagagtatcagcctcctatagctgtc
gatgggaaggtgcctcggaatgagtttgggaacgtgtacctcttcctgcccagcatgatg
cccgtcggctgtgtccagatgaccctgcctaacctgaaccgggtggcacgcaagctgggc
atcgactgcgtgcaggccatcactggcttcgatttccatggaggctattgccatccagta
actgatggctacattgtctgtgaggaattcagagacgtgctgctggctgcttgggagaat
gaacaggccatcattgaaaagaaggagaaggagaaaaaggaaaagcgggcgctggggaac
tggaagctgctggtcagaggactcctcatcagagagaggctgaaactccgctatggggcc
aagagcgaggcagcagctccccatgctgctggaggcggactctcttctgatgaagaggaa
gggaccagttcacaagcagaagcagccagagtcctggctgcctcctggccacagaaccga
gaggatccagaacagaagtccgagtacactaagatgactcggaagaggcgggcggcagag
gcttcccacctctttccgtttgagaagctgtga

DBGET integrated database retrieval system