KEGG   Mus musculus (mouse): 225997Help
Entry
225997            CDS       T01002                                 

Gene name
Trpm6, CHAK2, TRPM6/CHAK2
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 6 (EC:2.7.11.1)
  KO
K04981  
transient receptor potential cation channel subfamily M member 6 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    225997 (Trpm6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     225997 (Trpm6)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   225997 (Trpm6)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   225997 (Trpm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 B
AA seq 2028 aa AA seqDB search
MQVKKSWIEGVFYKRECNKFIPSSKDPHRCTPGCQICHNLVRCYCGRLIEEHHGLDRAWN
LSVTEGHGDEQWSVEKHTVKSPTDTFGTINFQDGEHIHHSKYIRTSWDTKSDHLLHLMLK
EWNMELPKLVISVHGGLQNFKISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGD
ALKAHSSKSLRKIWTVGIPPWGVIENQRELVGKDVVCMYQTLGNPLSKLTTLNCMHSHFI
LCDDGTVGMYGNEEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVILWVWETVKN
KEPVVVCEGTGRAADLLAFTYKHLEDGGILRPQVKEELFCLIQNMFNFSLRQSKHLFQIL
MECMVHKDSITIFDADSEEHQDLDLAILTALLKGTSLSISEQLNLAMAWDRMDIAKKHIL
TYGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELYNTKQGPTNKF
LRHLVQDVKQHTLLSSYRITLIDIGLVIEYLIGGAYRSSYTRKSFRILYNNLYRKHKSVS
SFAQGLSQHSLHQRHSLRNRKESSESTLHSQFFRTAQPYKSKEKPEDSQKSKKKSKERQS
LSEEPEAAGFIYPYNDLLVWAVLMKRQNMAMFFWQHGEEATVKAVIASILYRAMAREAKE
SNMVDDTSEELKNYSEQFGQLALDVLEKAFKQNEPMAMKLLTYELKNWSNSTCLKLAVSG
GLRPFVSHSCTQMLLTDMWMGRLKMRKNSWLKIIISILLPPMILTLEFKSKAEMSHVPQS
QDFQFTWNYSDQGLSNTKESACVKDYDLERGPDEKPDEPLHLDLRNVPQSLPWTRRVYEF
YSAPFVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVHEWLVIIYIFTNAIEKVREICISE
PSKFKQKVKMWLSEYWNLMETVAIGLFAVGFGLRWGHPPLQTAGRLIYCIDIIFWFSRLM
DFFAVNQHAGPYVTMIAKMAANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWRLARDIV
FEPYWMMYGEVYASDIDVCSNETSCPPGSFLTPFLQAVYLFVQYIIMVNLLIACFNNIYL
DIKSISNKLWKYNRYRYIMTYHQKPWLPPPFILLNHLCLLLRGLCCRPAPQDQEEGDGGL
KLYLTKDDLKKLHDFEEQCVEKYFHEKTEGLNCSFEEQIRMTSERVSEMFFQLKEMNEKV
SFIKDSLLSLDSQVGHLQDLSAITVDTLKVLSAVDTLQEDEILLANRKHSTCRKRPHSWT
NVICAKVLSDMESCGKKKLQYYSMPPSLLRSLARSQLPPSVQRGALVEVTHSKREASHVR
EEQEEREMEQRTTASGISHVRQAHSKYGQFLLVPSSGKQVPLSLETPPHLFRSSEEAGID
GLVLEHIHQSDLTTHLPQQTPAASHQALVAEHKDQHEAVTQMSDKPAKAEQDLLAFSGTP
APMTVTSLPSRAISMQDEGGYVNWAFSENDETGVFSFKKKWKTCLASTCNSDSNPGGDYF
LHTGGRSGLDNSRRLAQSCECPAGPWTQARRSFWINPLCRDKALIKSHSFRFHKEEKLRK
TWKNNSHSKSLETRSTWLKAKLLTKTRSLSKKKRKTQGLQVPVITVNACYQSDQLNAEPG
ETNTTEEFSKKWLSVSNFSQIGLEPYIYQKMKMKEIKRHTTQASDHLRQPQENRDKTPTW
NSGSTSLSRSFLTRSPNEVHKISTSLKSPQEPHHHYSAIERNNLMRLSQTIPFTPIQLFT
GEEVTIYKLEESSPLTLDKSMSSWSQHGRAAMIQVLSQEEMDGGLRKAMRVISTWSEDDV
LKPGQVFIVKSFLPEVVQTWYKIFQESTVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPY
TPRFLEVSLVYCHSANQWLTIEKYMTGEFRKYNNNNGDEIAPTNTLEELMLAFSHWTYEY
TRGELLVLDLQGVGENLTDPSVIKPEDKQSRGMVFGPANLGEDAIRSFIAKHRCNSCCGK
LRLPDLKRNDYSLSRTHCNLGFGQTIEPTEELPERDKNRSSLEDHTRL
NT seq 6087 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcaagaaatcctggatcgaaggggtattctacaagagagagtgtaacaaattc
atacccagctcaaaagaccctcacagatgcactccaggctgccaaatctgccacaattta
gtcaggtgttactgtggccggctgattgaagaacaccatgggctggatcgtgcctggaac
ctctcagtcactgagggccatggggatgagcagtggtctgtggagaagcacacagtgaaa
agccctacagataccttcggcaccattaatttccaagatggagaacatatccaccactcc
aagtacattagaacttcttgggatacaaaatcggatcatctgttgcacttaatgctgaaa
gagtggaatatggaactgccaaagcttgtgatctccgtccatgggggtcttcagaacttc
aagatatcctccaagctcaaagagaccttcagccagggtctggtcaaagctgcagagacc
acaggagcatggataattacagaaggcataaactcaggagtgtccaagcacgttggggat
gccctaaaagcccattcctctaagtctttgaggaaaatctggacagttggaatccctcct
tggggagtcattgagaaccagagagagctggtcggaaaagatgtggtgtgtatgtaccag
acactgggtaacccactcagcaagctcaccacgctaaactgtatgcactctcacttcatc
ctgtgtgatgatgggactgtgggcatgtatggaaatgaagagaagctcaggcggaacctg
gagaagcatctctcaatgcagaagatacacacttgctcaagacaaggtgtgcctgtggtg
gggctggtgatggaaggaggtcccaatgtcatcctctgggtatgggagaccgtcaagaac
aaggagcccgtggtggtgtgcgaggggacaggcagagctgctgacctcttggccttcact
tacaaacatttggaggatggagggattctacgccctcaggtgaaagaagagctcttctgt
ttgattcagaacatgttcaactttagccttagacagtctaagcaccttttccaaattcta
atggagtgcatggtacacaaggattctatcaccatatttgatgctgattctgaagagcac
caagatcttgatttggccatcctcacggctctactgaagggtacaagcttatcaatatca
gaacaattaaatctggcaatggcttgggatagaatggacattgccaagaaacatatccta
acttatggacaacattggaagcctggtgctctagaacaagcaatgctagatgctttagtg
atggatcgagtggactttgtgaaacttttgatagagaatggggtgaacctccaccgcttc
ctcaccatccctcggctggaagagctctataacacaaaacaaggaccaactaataaattt
ttgcgtcatcttgtccaagacgtaaagcagcacacccttctctcgagctatagaataaca
ctcattgacattgggctggtaatagagtacctcattggtggagcatatcggagcagctac
actaggaaaagtttcagaattctctacaacaacctctacagaaaacacaagagtgtgagc
agctttgctcagggcctctcccagcactctcttcatcagagacattcactgagaaataga
aaggagtcttctgaaagcacactgcactcccagttcttcaggacggcccagccctacaaa
tccaaggagaagcctgaggactctcaaaaatcaaagaagaagtccaaggaaagacaaagc
ctgtcagaggaacccgaggctgctggctttatctacccatacaatgaccttctggtgtgg
gcggtgctcatgaagaggcagaatatggccatgttcttctggcagcatggagaggaggcc
acagtcaaggcggtcattgctagtatcctctacagagccatggcccgggaagccaaggag
agcaacatggtggatgacacttcagaagagttgaaaaattactcagagcagtttggccag
ctcgccctggatgtattagagaaagccttcaagcagaacgagccgatggccatgaagctg
ctgacctatgagctcaagaattggagtaattccacctgcttgaaactggcggtctctgga
ggtctgcgcccttttgtgtcgcattcttgtacccaaatgctgctaacagacatgtggatg
gggcgtctgaaaatgagaaaaaattcctggctgaagataatcatcagtatcctcttacca
cccatgattttgacattggaatttaaaagcaaagcagagatgtcacatgtcccacagtcc
caggatttccagtttacatggaattacagtgaccagggcctgagtaacaccaaagaaagt
gcttgtgtgaaagactatgatttggaaagaggccctgatgagaaaccggatgaacctctg
catttagacttaagaaatgtgccccagagcctcccctggacccggagagtctacgagttc
tacagcgctccgtttgtcaagttttggttctacacgatggcttatttggcattcctcatg
ctgttcacttacacagtgttggtggagatgcagccccaacccagcgtgcacgaatggctt
gtcatcatctacatcttcaccaatgctattgagaaggtcagggagatctgcatttcagaa
ccaagcaagtttaagcagaaggtgaagatgtggctcagtgagtactggaacctcatggaa
actgtggctattggcctgtttgctgttggctttggcctacggtgggggcatccacctttg
caaactgcagggagactcatctactgcatagacatcatattttggttttctcggctcatg
gacttctttgctgtgaatcaacatgcaggtccatatgtgaccatgattgccaaaatggca
gcaaacatgttctacattgtgatcatcatggccattgtcctgctgagctttggcgtggcg
cgcaaagctatcctctcaccgaaggagcctccttcatggcgcctggctcgtgacatcgtc
tttgagccgtattggatgatgtatggagaagtctatgcttcagatatagatgtttgttca
aatgagacttcttgccctccgggttctttcctgactccattcctgcaagctgtctacctc
tttgtgcaatacatcatcatggtgaaccttctgattgcctgtttcaacaacatttactta
gatataaaatccatctcgaacaagctctggaaatacaaccgctatcgctacatcatgacc
taccaccagaagccctggctgcctcctccctttatcctgctgaatcacctgtgtctcctc
ctccgaggtctgtgctgtcgcccagccccacaggaccaggaagagggggacggagggcta
aagctctatctcactaaggatgacttgaaaaagcttcatgattttgaagagcagtgtgtg
gaaaaatatttccacgagaagacggaaggtctgaattgtagttttgaggaacaaattcga
atgacatcagaaagggtatcagagatgtttttccaactgaaagaaatgaatgaaaaagta
tcttttataaaggactccctactatccctggacagccaggtgggacaccttcaggacctc
tcggccataactgttgacaccttaaaggtcctttctgctgttgacaccttgcaagaagat
gagattcttttggccaacagaaagcattctacttgcagaaaacgtccccacagctggacc
aatgtcatctgtgcaaaggttctaagtgacatggaaagctgtgggaagaagaaacttcag
tattatagcatgcccccttctttgctgaggagcctcgctagaagtcagcttcccccaagt
gtgcagaggggtgcacttgtagaggttacgcacagtaagagagaggcctcacatgtaaga
gaagagcaggaggaacgagaaatggaacagaggacaacggcttctgggatttcccatgtc
agacaagcacactctaagtatggccagtttctcctggttccatcttctggaaagcaagtt
cctttgtctttggaaaccccgccacatcttttcagatcatctgaggaggcaggtatagat
ggtctggtattggagcatatacaccaaagtgatctcaccacccacttgcctcagcagacc
cctgctgcctcccaccaggcattggtagcggaacacaaagaccaacatgaggcagttaca
cagatgtcagacaaacctgccaaggcagaacaagacttgctcgcattcagtggcacacct
gctcccatgacagtgacttctcttccttcgagagccatcagcatgcaagatgaaggtgga
tatgtaaactgggcattttcagaaaatgatgaaacaggtgtgtttagctttaaaaaaaag
tggaaaacttgcttggcctccacttgcaatagtgactccaatcctggtggagactacttc
ctgcacactggaggtagatccggactggataactcaagaagactggcccagagttgtgag
tgcccagcaggaccgtggacccaggcaagaagatccttttggatcaatcctctctgcaga
gataaagctctcattaagagtcatagttttagattccacaaggaggagaaactgaggaag
acctggaagaacaacagtcattcaaaatccttagagaccaggtccacatggctcaaagca
aaactgctaaccaagacccggagcctgtcaaagaagaagaggaagacccaagggctccag
gtgccggtaataacagtcaatgcctgctatcaaagtgaccagttgaatgcagagccagga
gaaactaacaccactgaagagttcagcaagaaatggctctctgtatccaacttcagccag
ataggtttagagccttacatataccagaaaatgaaaatgaaggaaatcaagcgacatact
acacaagccagtgaccacctaaggcagccacaagagaaccgagataaaacccccacatgg
aattctgggagcaccagcctcagcaggagttttctaacaagaagtccaaatgaagttcac
aagatctcaacctccttaaaaagccctcaagagcctcaccaccattattcagccattgaa
aggaataatttaatgagactgtctcagaccataccgtttacaccaatccagctgttcaca
ggagaggaagtgaccatctacaagcttgaagaaagttctcctctgaccctggataagagc
atgtcctcttggtcgcagcatggcagagctgccatgattcaggtgctgtcacaagaggaa
atggatgggggtctccgcaaagccatgcgagttatcagcacctggtctgaggatgatgtt
ctcaagcctgggcaggttttcattgtgaagtcttttctccccgaggttgtgcagacgtgg
tataaaatcttccaggagagcactgtgcttcatctttgccttagggaaattcaacagcaa
agagctgcccaaaaactcatctatacctttaaccaagtaaaaccacaaaccattccctat
acaccaaggtttctcgaggtttccttggtctactgccattcagccaaccaatggttaacc
attgagaagtacatgacaggggagttccggaaatacaataacaacaatggtgatgaaata
gctcccaccaataccctggaagaactgatgttggctttctctcactggacctatgaatat
acccggggagagctgctggttttagatttgcaaggtgttggagaaaatttgacagatccg
tctgttataaaaccggaagacaaacaatcaagagggatggtgtttggaccggccaattta
ggggaagatgcaattagaagcttcattgcaaaacatcgctgcaactcctgctgtgggaag
ctcagactgccggatttaaaaaggaatgattactccctttcaagaacacactgcaacttg
ggatttgggcaaaccattgaaccaactgaggagcttccagaaagagacaaaaatagaagt
tccctggaagatcacacacgcctttaa

DBGET integrated database retrieval system