KEGG   Mus musculus (mouse): 22612Help
Entry
22612             CDS       T01002                                 

Gene name
Yes1, Yes, p61-Yes
Definition
(RefSeq) YES proto-oncogene 1, Src family tyrosine kinase (EC:2.7.10.2)
  KO
K05705  
tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular community
   04520 Adherens junction
    22612 (Yes1)
   04530 Tight junction
    22612 (Yes1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     22612 (Yes1)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   22612 (Yes1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 B1; 5 17.33 cM
AA seq 541 aa AA seqDB search
MGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSSTKGASVNFNSLSMTPF
GGSSGVTPFGGASSSFSVVSSSYPTGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKSGYIPSNYVVPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLICKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcattaaaagtaaagaaaacaaaagtccagccataaaatacacaccggaaaat
cttacagagcctgtaagcccaagtgccagtcattatggagtggaacatgctacagttgcc
ccgacctcttccacaaagggagcatcagttaattttaacagtctttccatgacacccttt
ggagggtcctcaggggtgactccttttggaggagcgtcttcctcattctcagtggtgtca
agttcatatcctacaggtttaacaggtggtgtcactatatttgtggccttgtatgattat
gaagctagaactacagaagacctttcctttaagaagggtgaacgatttcaaataattaac
aatacggaaggagactggtgggaagcaagatcaattgctaccggaaagagtggttatatc
cctagcaattacgtagtgcctgcagattccattcaggcagaagaatggtattttggcaaa
atggggagaaaagatgcggaaagattacttctgaatcctgggaatcagcgaggtattttc
ttagtaagagaaagtgaaactactaaaggtgcttactccctctcaatccgtgattgggat
gaggtgaggggtgacaatgtgaagcattacaagatcagaaaacttgacaatggtggctac
tacatcacgaccagagctcagtttgatacactgcagaagctggtgaagcactacacagaa
catgctgatggattatgccacaagttaacaactgtgtgtcctactgtgaaaccccagact
caaggtctggcaaaagatgcttgggaaatccctcgagaatcattgcgactagaggtgaaa
ctaggtcaaggatgctttggggaagtgtggatgggaacatggaatggaactacaaaagta
gcaatcaaaacactaaagccaggtacaatgatgccagaagcattccttcaagaagctcag
ataatgaaaaagctaagacacgataaacttgttccactctatgcagttgtttctgaagag
cccatttatattgtcaccgagtttatgtcaaaaggaagcttgttagatttccttaaagaa
ggagatggaaagtatttgaagcttccacagctggttgatatggctgctcagatcgctgat
ggcatggcgtatattgaaagaatgaactatattcaccgagatctccgagctgctaatatt
cttgtaggagaaaatcttatatgcaaaatagcagattttggcttagcaagattaattgaa
gacaatgaatacacggcaagacaaggtgcaaaatttccaatcaagtggacagctcctgag
gctgctctgtatggtcgatttacaataaagtcagatgtgtggtcatttggaattctacag
acagagctggtaacaaaaggaagagtgccatatccaggtatggtaaaccgtgaagtattg
gaacaagtagagcggggatacagaatgccttgcccccagggctgtcccgaatccctccat
gaattgatgaatctttgctggaagaaggatcctgatgaaagaccaacatttgaatatatt
cagtccttcttggaagactacttcactgctacagagccacagtaccaaccaggagaaaat
ttataa

DBGET integrated database retrieval system