KEGG   Mus musculus (mouse): 22627Help
Entry
22627             CDS       T01002                                 

Gene name
Ywhae, AU019196
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
  KO
K06630  
14-3-3 protein epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Neurotrophin signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    22627 (Ywhae)
   04151 PI3K-Akt signaling pathway
    22627 (Ywhae)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    22627 (Ywhae)
   04114 Oocyte meiosis
    22627 (Ywhae)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    22627 (Ywhae)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    22627 (Ywhae)
  Infectious diseases
   05169 Epstein-Barr virus infection
    22627 (Ywhae)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    22627 (Ywhae)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22627 (Ywhae)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 45.92 cM; 11 B2
AA seq 255 aa AA seqDB search
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggcagagcaggccgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggacgtggagctgacagttgaa
gaacgaaaccttttatctgttgcatataaaaatgtgattggagccagaagagcatcctgg
agaataatcagcagcattgaacagaaggaagaaaacaagggaggagaggacaaattaaag
atgattcgggagtaccggcaaatggttgaaactgagctcaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgagtttgccacaggaaatgac
aggaaggaggcagcagagaacagcctcgtggcttacaaagctgctagtgacattgcgatg
acagaacttcctccaacgcaccccattcgtttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggacacgctgagtgaagaaagctataaggactctacgctcatc
atgcagctgctacgtgataacctgacgctgtggacctcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

DBGET integrated database retrieval system