KEGG   Mus musculus (mouse): 226304Help
Entry
226304            CDS       T01002                                 

Gene name
Npbwr1, Gpr7, Nbpwr1
Definition
(RefSeq) neuropeptides B/W receptor 1
  KO
K05268  
neuropeptides B/W receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    226304 (Npbwr1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide W / neuropeptide B
    226304 (Npbwr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 A1
AA seq 329 aa AA seqDB search
MHNLTLFESGGDNVSCGGSSLGCPNGSSLAPLPLPQPLAVAVPVVYGVICAVGLAGNSAV
LYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQY
NTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFAR
LDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVTTICALYTTLLCRLRAIQLDSH
AKALDRAKKRVTLLVAAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYA
NSCLNPFLYAFLDDSFRRSLRQLVSCRSA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcataacttaacgcttttcgagtctggaggggacaacgtgtcttgcggcggctcatct
ttgggctgtcccaacgggtccagcctggctcctctgccgctgccgcagccactggcggta
gcagtgcctgtcgtctacggggtaatttgcgccgtgggactggctggcaactctgcggtg
ctgtacgtactgctgcgcacgccgcgcatgaagactgtcaccaacgtgttcatcctcaac
ctggctatcgccgatgagctcttcaccctcgtgctgcccatcaacatcgcggacttcctg
ctgaggcgctggcccttcggggaggtcatgtgcaagctcattgtagccgtcgaccagtac
aacactttctctagcctctacttcctcgccgtcatgagcgccgaccgatacctggtggtt
ctggccacagcagagtcgcgccgggtgtccgggcgcacttacggtgcagcgcgtgctgtc
agtctggcggtgtgggcgctggtgacgctggtcgtgctgccctttgcggtattcgctcgg
ctggacgaggagcagggtcggcgccagtgcgtgctggtcttcccgcagcccgaggccttc
tggtggcgtgccagccgtctctacacactagtattgggctttgccatcccggtgaccacc
atctgtgctctctataccactctgctctgccgactgcgtgctatccagctagatagccac
gccaaggccctggatcgtgccaagaagcgcgtgaccttgttggtggcggcgattctggct
gtgtgcctcctctgctggacgccttatcacctgagtaccatagtggccctcaccaccgac
ctcccgcaaacgccgctggtcatcggcatctcttacttcatcaccagcctgagctatgct
aacagctgcctcaaccctttcctctatgccttcctggacgacagcttccgcagaagcctc
cggcaattggtgtcatgccgttcagcctga

DBGET integrated database retrieval system