KEGG   Mus musculus (mouse): 22631Help
Entry
22631             CDS       T01002                                 

Gene name
Ywhaz, 1110013I11Rik, 14-3-3zeta, AI596267, AL022924, AU020854
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  KO
K16197  
14-3-3 protein beta/theta/zeta
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    22631 (Ywhaz)
   04151 PI3K-Akt signaling pathway
    22631 (Ywhaz)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    22631 (Ywhaz)
   04114 Oocyte meiosis
    22631 (Ywhaz)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    22631 (Ywhaz)
  Infectious diseases
   05161 Hepatitis B
    22631 (Ywhaz)
   05169 Epstein-Barr virus infection
    22631 (Ywhaz)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    22631 (Ywhaz)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22631 (Ywhaz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 B3.1
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggcagagcgatatgat
gacatggcagcctgcatgaagtctgtcactgagcagggagctgagctgtcgaatgaggag
agaaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcgtggagg
gtcgtctcaagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgcgtgacatctgcaacgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcgcaaccagaaagcaaagtcttctatttgaaa
atgaagggtgactactaccgttacttggccgaggttgctgctggtgatgacaagaaagga
attgtggaccagtcacagcaagcataccaagaagcatttgaaatcagcaaaaaggagatg
cagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctattacgag
atcctgaactccccagagaaagcctgctctcttgcaaaaacagctttcgatgaagccatt
gctgaacttgatacattaagtgaagagtcgtacaaagacagcacgctaataatgcagtta
ctgagagacaacttaacattgtggacatcggatacccaaggagatgaagcagaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system