KEGG   Mus musculus (mouse): 226419Help
Entry
226419            CDS       T01002                                 

Gene name
Dyrk3, BC006704
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     226419 (Dyrk3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   226419 (Dyrk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 E4; 1
AA seq 586 aa AA seqDB search
MGGAARDRGRKDAALPGAGLPPQQRRLGDGVYDTFMMIDETKGPPYSDTFSNPSEAPVSR
RLNITTEPLTRGHTQHFVNGSEMKVEQLFQEFGNRRSNTLQSDGISNSEKSSPASQGKSS
ESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGV
IGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVR
NEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKK
NKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCF
EYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACM
IELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSK
DWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKPLTMDKVPGKRVV
NPTNAFQGLGSKLPPVVGIASKLKANLMSETSGSIPLCSVLPKLIS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgcagcccgcgatcgcgggaggaaggacgcggcgctgccgggggccgggctc
ccgccgcagcagcggaggttgggggatggtgtctatgatactttcatgatgatagatgaa
accaagggcccaccctattcggacacattcagcaacccctctgaagcacctgtctccaga
aggctaaatattaccactgagccactcacgagaggccacactcagcactttgtgaatgga
agtgagatgaaggtggaacagctgtttcaagaatttggcaacagaagatccaatactctc
cagtcagatggcatcagcaactcggaaaagtcttctccggcttctcaggggaaaagttcg
gaaagcctgagcgcggtgaagtgcaacctttcctccaggccgtctaaggtgctgccgctg
actcctgagcaagcgctgaagcagtataaacaccacctcactgcctacgagaagctggag
atcgtcagctacccagaaatctactttgtgggtccgaatgccaaaaagcggcagggagtt
attggtggtcccaataacggtggctacgacgatgcggatggggcctatattcatgtgccc
cgggaccatctggcttaccgctatgaggtgctgaaaatcatcggcaaggggagttttgga
caggtagcccgggtctatgatcacaaacttcggcagtacgtggccctgaaaatggtgcgc
aatgagaaacgcttccatcgccaggcggccgaggagatccggatcttggagcatcttaaa
aagcaagacaaaactggtagcatgaacgtcatccacatgctagaaagtttcaccttccgg
aaccacgtgtgcatggcctttgaactgctaagcatagacctgtatgagcttattaaaaaa
aacaagttccagggcttcagcgtccagttggttcggaagttcgcccagtccatcctacag
tccctggacgctctgcacaaaaacaagatcatccactgcgacctgaagccggaaaacatt
ctcctgaaacaccacggccgaagcgccaccaaggtcatcgactttggctccagctgcttc
gagtatcagaagctttacacgtatatccagtcccgcttctacagagccccagagatcatc
ctggggtgccgctacagcaccccgatcgacatatggagctttggttgcatccttgcagaa
cttttgacaggacagcccctgttccctggagaggacgaaggagaccagttggcctgcatg
atagagttgctaggaatgccaccgcagaaacttctggagcaatccaagcgtgccaagtac
tttattaactccaaaggcttgcctcgatactgctccgtatctacccagacggacgggagg
gtggtgcttctcgggggtcgctcacgcaggggtaaaaagcgaggcccgccaggcagcaaa
gactgggcaaccgcactgaagggctgtggtgactacttgttcatagagtttctgaaacga
tgcctccagtgggacccctctgcccgcctcaccccggctcaagcattaagacatccttgg
attagcaagtctacacccaaacctctcaccatggacaaggtgccagggaagcgggtagtt
aaccctacaaatgctttccagggactgggttccaagctgcctccagtcgttgggatagcc
agtaagcttaaagctaacctaatgtccgaaaccagtggtagtatacctctgtgcagtgta
ttgccaaagctgattagctag

DBGET integrated database retrieval system