KEGG   Mus musculus (mouse): 22644Help
Entry
22644             CDS       T01002                                 

Gene name
Rnf103, AW146237, AW212918, Zfp103, kf-1
Definition
(RefSeq) ring finger protein 103
  KO
K15695  
E3 ubiquitin-protein ligase RNF103 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22644 (Rnf103)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    22644 (Rnf103)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 C1; 6 32.16 cM
AA seq 683 aa AA seqDB search
MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYS
GLPEKKDVRELVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL
VQVIANDRSPLVGKIHWEKMVKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQT
STSKGKVMLKEYSGRKIEVEHIFKWITAHAASRIKTIYNVEHLKEEWNKSDQYWVKIYLF
ANLDQPPAFFSALSIKFTGRVEFIFVNVENWNNKSYMTDIGIYNMPSYILRTPEGIYRYG
NHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL
GTYNSLLIISWLPVLGFLQLPYLDSFYDYSLRLLRYSNTTTLASWVRADWMFYTSHPALF
LSTYLGHGLLIDYFEKKRRRSNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVDSD
WDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSESSQDTENDSDS
DNMDTFSSSKDIFEDKQSVVHSSPGRTSHCDTEACSCANKCESSPCERKRRSYGSHNTDE
DMEPDWLTWPAGTLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVC
RWPSYKKKQPYAQQQPLSNDVPS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgaagctgtttttcttgctcctgtatttcctggtcctgttcgtcctggccagg
ttttttgaggccattgtgtggtacgagactggcatctttgctactcagctggtggatccg
gtggcattgagcttcaagaagctgaagaccattctggagtgtcgagggctgggctactcc
gggctgccggagaagaaagatgttcgggagctggtggagaagtcaggtgacttgatggaa
ggtgaactctattctgctcttaaggaagaagaggcatctgagtctgtttctagtaccaat
ttcagtggtgaaatgcatttctatgagcttgtggaagacacaaaagatggcatctggctg
gttcaggtcatagcaaatgacagaagtcctttggtgggtaaaatccactgggagaaaatg
gtgaaaaaagtgtcaagatttggaatacggacaggcactttcaactgttccagtgatccc
aggtactgcagaaggagaggctgggtgcgttccacactcatcatgtctgtgccacaaaca
agtacatctaaagggaaagtcatgcttaaagagtacagtggacgcaagattgaagtagag
cacatttttaagtggataactgcccatgcagcttctcggatcaaaactatatataatgtg
gagcatttgaaggaagaatggaataaaagtgatcaatactgggtaaaaatatacctattt
gcaaaccttgaccaaccgccagctttcttctctgcattaagtataaaatttactggaaga
gttgagtttatttttgttaatgtggaaaattggaacaacaagagttatatgacagatatt
ggtatttataacatgccatcatacatacttagaactcctgaaggaatttatagatacgga
aaccacacaggtgaatttatatcccttcaggccatggattcatttctgcgctcattacaa
cctgaagtaaatgatctgtttgttttgagtttggttctagttaatcttatggcttggatg
gacttatttattacacaaggagcaaccatcaagcgatttgtggttctcataagcacttta
gggacatacaattccctattaattatttcttggctacctgtgttgggctttctacagctc
ccttacttagatagcttttatgactatagtttaagattgctgcggtattctaatacaacc
acactggcttcgtgggtaagggcagactggatgttttacacttcacacccagccctgttt
ctcagtacataccttggacatggtttgctaattgattactttgagaagaagagacgtcgc
agcaacaatgatgaagttaatgcgaataatttagaatggttatcaagtctgtgggactgg
tacaccagctacctcttccacccgattgcttcttttcagaactttcctgtagactctgat
tgggacgaagaccctgacttattcttggaacggttagctttccctgacctttggcttcac
cctctgataccaactgattatattaaaaacttaccaatgtggcgatttaaatgtcttggg
gttcagtctgaagaagaaatgtcagagagttctcaagacactgaaaatgactcggatagt
gacaacatggacacttttagtagtagtaaggatatatttgaagataaacaaagcgttgtt
cacagttctccaggaagaacaagtcactgtgatactgaggcttgttcatgtgccaataaa
tgtgagagcagcccatgtgaaaggaagaggaggtcgtatggatcacataatactgatgaa
gatatggaaccggactggttaacttggcctgcgggtacgctgcactgtactgaatgtgtt
gtttgccttgagaattttgaaaatggatgtttgctaatggggttgccttgtggtcacgtg
tttcaccagaattgcattgttatgtggttggctgggggccgacactgttgccctgtttgt
cgttggccttcatataagaaaaagcagccatatgcacaacaacagccgttgtcaaatgat
gttccatcttaa

DBGET integrated database retrieval system