KEGG   Mus musculus (mouse): 226519Help
Entry
226519            CDS       T01002                                 

Gene name
Lamc1, Lamb2
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    226519 (Lamc1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    226519 (Lamc1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    226519 (Lamc1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    226519 (Lamc1)
   05222 Small cell lung cancer
    226519 (Lamc1)
  Neurodegenerative diseases
   05020 Prion diseases
    226519 (Lamc1)
  Infectious diseases
   05146 Amoebiasis
    226519 (Lamc1)
   05145 Toxoplasmosis
    226519 (Lamc1)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      226519 (Lamc1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      226519 (Lamc1)
     Laminin-2 Extracellular matrix (ECM) components
      226519 (Lamc1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      226519 (Lamc1)
   VLA-3
      226519 (Lamc1)
     Laminin-10 Extracellular matrix (ECM) components
      226519 (Lamc1)
     Laminin-11 Extracellular matrix (ECM) components
      226519 (Lamc1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      226519 (Lamc1)
     Laminin-8 Extracellular matrix (ECM) components
      226519 (Lamc1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      226519 (Lamc1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      226519 (Lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 G3; 1 65.3 cM
AA seq 1607 aa AA seqDB search
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPVKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKKKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgctggccctgcagccccgggggcggctgtggccgctg
ttggctgtgctggcggctgtggcgggctgtgtccgggcggccatggacgagtgcgcggat
gagggcgggcggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccgcccgaggagtactgcgtgcagactggggtg
accggagtcactaagtcctgtcacctgtgcgacgccggccagcagcacctgcaacacggg
gcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgcctcaagttccacaccagccgtccagagagcttcgccatc
tataagcgcactcgggaagacgggccctggattccttatcagtactacagtgggtcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggaccggaggggacgagcagcag
gccttgtgtactgatgaattcagtgacatttcccccctcaccggtggcaacgtggccttt
tcaaccctggaaggacggccgagtgcctacaactttgacaacagccctgtgctccaggaa
tgggtaactgccactgacatcagagtgacgctcaatcgcctgaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcttactattacgcaatctcagactttgctgtg
ggcggcaggtgtaaatgtaacggacatgccagcgagtgtgtaaagaacgagtttgacaaa
ctcatgtgcaactgcaaacataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaatgaccggccgtggaggagggcgactgctgagagcgccagcgagtgccttccttgt
gactgcaatggccgatcccaagagtgctactttgatcctgaactataccgttccactgga
catggtggccactgtaccaactgccgggataacacagatggtgccaagtgcgagaggtgc
cgggagaatttcttccgcctggggaacactgaagcctgctctccgtgccactgcagccct
gttggttctctcagcacacagtgtgacagttacggcagatgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgttgtcagcctgggttccattccctcactgaggcaggatgc
aggccatgctcctgcgatccttcgggcagcacagacgagtgtaatgttgaaacaggaaga
tgcgtttgcaaagacaatgttgaaggcttcaactgtgagagatgcaaacctggatttttt
aatctggagtcatctaatcctaagggctgcacaccctgcttctgctttggccattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccacctttcagattgat
gaggatgggtggcgcgtggagcagagagatggctcggaggcgtctctggagtggtcctca
gacaggcaagatattgccgtaatctcagacagttactttcctagatacttcatcgcccct
gtgaagttcctgggcaaccaggtcctgagttatgggcagaatctttccttctccttccga
gtggacagacgagacactcgcctctccgcagaggaccttgtgctcgaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcctaccccagcgagaccactgtgaag
tacatcttcaggctccatgaagcaacggattacccttggaggcccgctctctccccgttt
gaatttcagaagctcctgaacaacttgacctctatcaagatccgtggtacatacagcgag
aggagcgctgggtacttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cctgcaacgtgggtggagtcctgcacctgtccagtgggatacgggggacagttctgtgag
acgtgcctcccagggtacagaagagaaactccaagccttggaccttatagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgacccggagacaggtgtctgtgactgc
agagacaatacagccggcccccactgtgagaaatgtagcgatgggtactatggggactca
accctgggcacctcctctgactgccagccttgtccctgccccggtggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacgcactgtccgactggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcaatgggcctgtg
agactgtgccgcccgtgccagtgtaacgacaacatagaccccaacgcggttggcaactgc
aaccgcctgacgggcgagtgcctgaagtgcatctataacacggctggtttctactgcgac
cggtgcaaggaagggtttttcggaaatcccctggctcccaatccagccgacaaatgcaaa
gcctgcgcctgcaatccctacgggacagtgcagcaacagagcagctgtaacccggtgacc
ggacagtgccagtgtctgcctcatgtgtctggccgcgactgcggtacttgtgaccctggc
tactacaacctgcagagcgggcaaggctgcgagaggtgtgactgccatgctttgggttcc
accaatgggcagtgtgacatccgcaccgggcagtgtgagtgccagcctggcatcaccggc
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcaccatgaaggatccctttcactccagtgtaaagaggacggccgttgtgaa
tgcagggaaggctttgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcctggcctggctgccaggagtgtccggcttgttaccgactggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttagagagcctcatcgccaaccttggcactggg
gatgacatggtgacagatcaagcctttgaggacagacttaaggaagcagaaagggaggtg
acagaccttctccgtgaggctcaggaagtcaaagatgtagatcaaaatctgatggatcgc
cttcagagagtaaatagcagcctgcatagccaaattagccgactgcagaatatccggaat
actatcgaagagaccgggatcttggctgagcgagcacggtcccgagtggagagtacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggagccaaacaacatgaccctcttggcagaagaa
gcccgaaagcttgcagagcgtcataaacaggaagccgatgacattgtacgagtggcaaag
acagccaacgagacttcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcgctggagattgaagaacttaaccggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgcccgagtccatgaggaagccaagcgtgcaggtgac
aaagccgtagagatctatgccagtgtggcccagctgacccctgtggactctgaggccctg
gagaatgaagcaaataaaatcaagaaagaagctgcagacctggaccgtctgattgaccag
aagctaaaggattacgaggacctcagggaagacatgagaggaaaggaacatgaagtgaag
aaccttctagagaaggggaaagctgaacagcagaccgccgaccaactcctagctcgagcc
gatgctgccaaggcccttgctgaagaagctgctaagaagggacgcagtaccttacaagaa
gccaatgacattctcaacaacctgaaagattttgatagacgcgtgaacgataacaagaca
gccgcggaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcccagctagcgctgggcaatgctgccgctgacgccacggaggcc
aagaacaaggcccatgaggcagagaggattgccagcgccgtgcagaagaatgccaccagt
accaaggcggacgcagaaagaaccttcggggaagttacagatctggataatgaggtgaat
ggtatgctgaggcagctggaggaggcagagaatgagctgaagaagaagcaagatgatgcc
gaccaggacatgatgatggcagggatggcttcgcaggctgctcaggaggctgagctcaat
gccagaaaggccaaaaactctgtcagcagcctcctcagccagctgaacaacctcttggat
cagctaggacagctggacacagtggacctgaacaagctcaatgagatcgaaggctccctg
aacaaagccaaagacgaaatgaaggccagcgacctggacaggaaggtgtctgacctggag
agcgaggctcggaagcaggaggcagccatcatggactataaccgggacatagcagagatc
attaaggatattcacaacctggaggacatcaagaagaccctaccaaccggctgcttcaac
accccgtccatcgagaagccctag

DBGET integrated database retrieval system