KEGG   Mus musculus (mouse): 226519Help
Entry
226519            CDS       T01002                                 

Gene name
Lamc1, Lamb2
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mmu04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:mmu05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:mmu05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:mmu05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mmu05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 G3; 1 65.3 cM
AA seq 1607 aa AA seqDB search
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPVKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKKKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgctggccctgcagccccgggggcggctgtggccgctg
ttggctgtgctggcggctgtggcgggctgtgtccgggcggccatggacgagtgcgcggat
gagggcgggcggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccgcccgaggagtactgcgtgcagactggggtg
accggagtcactaagtcctgtcacctgtgcgacgccggccagcagcacctgcaacacggg
gcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgcctcaagttccacaccagccgtccagagagcttcgccatc
tataagcgcactcgggaagacgggccctggattccttatcagtactacagtgggtcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggaccggaggggacgagcagcag
gccttgtgtactgatgaattcagtgacatttcccccctcaccggtggcaacgtggccttt
tcaaccctggaaggacggccgagtgcctacaactttgacaacagccctgtgctccaggaa
tgggtaactgccactgacatcagagtgacgctcaatcgcctgaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcttactattacgcaatctcagactttgctgtg
ggcggcaggtgtaaatgtaacggacatgccagcgagtgtgtaaagaacgagtttgacaaa
ctcatgtgcaactgcaaacataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaatgaccggccgtggaggagggcgactgctgagagcgccagcgagtgccttccttgt
gactgcaatggccgatcccaagagtgctactttgatcctgaactataccgttccactgga
catggtggccactgtaccaactgccgggataacacagatggtgccaagtgcgagaggtgc
cgggagaatttcttccgcctggggaacactgaagcctgctctccgtgccactgcagccct
gttggttctctcagcacacagtgtgacagttacggcagatgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgttgtcagcctgggttccattccctcactgaggcaggatgc
aggccatgctcctgcgatccttcgggcagcacagacgagtgtaatgttgaaacaggaaga
tgcgtttgcaaagacaatgttgaaggcttcaactgtgagagatgcaaacctggatttttt
aatctggagtcatctaatcctaagggctgcacaccctgcttctgctttggccattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccacctttcagattgat
gaggatgggtggcgcgtggagcagagagatggctcggaggcgtctctggagtggtcctca
gacaggcaagatattgccgtaatctcagacagttactttcctagatacttcatcgcccct
gtgaagttcctgggcaaccaggtcctgagttatgggcagaatctttccttctccttccga
gtggacagacgagacactcgcctctccgcagaggaccttgtgctcgaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcctaccccagcgagaccactgtgaag
tacatcttcaggctccatgaagcaacggattacccttggaggcccgctctctccccgttt
gaatttcagaagctcctgaacaacttgacctctatcaagatccgtggtacatacagcgag
aggagcgctgggtacttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cctgcaacgtgggtggagtcctgcacctgtccagtgggatacgggggacagttctgtgag
acgtgcctcccagggtacagaagagaaactccaagccttggaccttatagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgacccggagacaggtgtctgtgactgc
agagacaatacagccggcccccactgtgagaaatgtagcgatgggtactatggggactca
accctgggcacctcctctgactgccagccttgtccctgccccggtggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacgcactgtccgactggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcaatgggcctgtg
agactgtgccgcccgtgccagtgtaacgacaacatagaccccaacgcggttggcaactgc
aaccgcctgacgggcgagtgcctgaagtgcatctataacacggctggtttctactgcgac
cggtgcaaggaagggtttttcggaaatcccctggctcccaatccagccgacaaatgcaaa
gcctgcgcctgcaatccctacgggacagtgcagcaacagagcagctgtaacccggtgacc
ggacagtgccagtgtctgcctcatgtgtctggccgcgactgcggtacttgtgaccctggc
tactacaacctgcagagcgggcaaggctgcgagaggtgtgactgccatgctttgggttcc
accaatgggcagtgtgacatccgcaccgggcagtgtgagtgccagcctggcatcaccggc
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcaccatgaaggatccctttcactccagtgtaaagaggacggccgttgtgaa
tgcagggaaggctttgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcctggcctggctgccaggagtgtccggcttgttaccgactggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttagagagcctcatcgccaaccttggcactggg
gatgacatggtgacagatcaagcctttgaggacagacttaaggaagcagaaagggaggtg
acagaccttctccgtgaggctcaggaagtcaaagatgtagatcaaaatctgatggatcgc
cttcagagagtaaatagcagcctgcatagccaaattagccgactgcagaatatccggaat
actatcgaagagaccgggatcttggctgagcgagcacggtcccgagtggagagtacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggagccaaacaacatgaccctcttggcagaagaa
gcccgaaagcttgcagagcgtcataaacaggaagccgatgacattgtacgagtggcaaag
acagccaacgagacttcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcgctggagattgaagaacttaaccggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgcccgagtccatgaggaagccaagcgtgcaggtgac
aaagccgtagagatctatgccagtgtggcccagctgacccctgtggactctgaggccctg
gagaatgaagcaaataaaatcaagaaagaagctgcagacctggaccgtctgattgaccag
aagctaaaggattacgaggacctcagggaagacatgagaggaaaggaacatgaagtgaag
aaccttctagagaaggggaaagctgaacagcagaccgccgaccaactcctagctcgagcc
gatgctgccaaggcccttgctgaagaagctgctaagaagggacgcagtaccttacaagaa
gccaatgacattctcaacaacctgaaagattttgatagacgcgtgaacgataacaagaca
gccgcggaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcccagctagcgctgggcaatgctgccgctgacgccacggaggcc
aagaacaaggcccatgaggcagagaggattgccagcgccgtgcagaagaatgccaccagt
accaaggcggacgcagaaagaaccttcggggaagttacagatctggataatgaggtgaat
ggtatgctgaggcagctggaggaggcagagaatgagctgaagaagaagcaagatgatgcc
gaccaggacatgatgatggcagggatggcttcgcaggctgctcaggaggctgagctcaat
gccagaaaggccaaaaactctgtcagcagcctcctcagccagctgaacaacctcttggat
cagctaggacagctggacacagtggacctgaacaagctcaatgagatcgaaggctccctg
aacaaagccaaagacgaaatgaaggccagcgacctggacaggaaggtgtctgacctggag
agcgaggctcggaagcaggaggcagccatcatggactataaccgggacatagcagagatc
attaaggatattcacaacctggaggacatcaagaagaccctaccaaccggctgcttcaac
accccgtccatcgagaagccctag

DBGET integrated database retrieval system