KEGG   Mus musculus (mouse): 226977Help
Entry
226977            CDS       T01002                                 

Gene name
Actr1b, 2310066K23Rik, AA960180, AI851923, Arp1b
Definition
(RefSeq) ARP1 actin-related protein 1B, centractin beta
  KO
K16575  
centractin
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Dynactin complex
     226977 (Actr1b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     226977 (Actr1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   226977 (Actr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 B
AA seq 376 aa AA seqDB search
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGP
KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN
REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRVDIAGRDVSRYLRLLLRKEGADFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQ
YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVLAFAIHKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGSRAIHRKTF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctacgacatcatcgctaaccagcccgtggtcatcgacaatggttcaggggtg
atcaaggctggctttgcaggagaccagattcctaagtactgtttcccaaactatgtcgga
cggccaaagcacatgcgggttatggctggagccctggagggggacctgttcattggaccg
aaagcagaggagcaccgggggctgctgaccatccgataccccatggaacacggtgtggta
cgggattggaatgacatggaacgcatctggcagtacgtctactctaaggaccagctgcag
accttctctgaggagcatcctgttcttctaacggaggccccactgaaccccagtaagaac
cgggagaaggcggcagaggtcttctttgaaaccttcaatgttcctgcactgtttatctcc
atgcaggccgtgcttagcctgtacgcaacaggacgcaccacaggagtggttttagattcg
ggggacggggtcactcacgctgtccccatctatgagggctttgccatgccacactccatc
atgcgggttgacattgcgggccgggacgtctctcgatatctgaggctgctgctacgcaag
gaaggggcagacttccacacctcagctgagtttgaggtggtccggaccatcaaagagcga
gcttgctatctgtccatcaacccacaaaaggacgaggctctcgagactgagaaggtgcag
tacacccttccagacggcagcacgcttgatgtggggcctgcgcgcttccgagcccctgaa
ctgctgttccagccagacctggtaggggatgagagtgagggactccatgaagttctggcc
ttcgccatccacaagtctgacatggacctccgccggacactcttctccaatatcgtgctg
tcagggggctcaacactcttcaaaggctttggagacaggttactaagtgaagtaaagaag
cttgccccgaaggatgttaaaatcaagatctctgctcctcaggaacggctgtactccacg
tggattggaggctccatcctcgcctcactggataccttcaagaagatgtgggtatccaaa
aaggaatatgaagaagatggctcccgcgcgattcatcgcaaaaccttctaa

DBGET integrated database retrieval system