KEGG   Mus musculus (mouse): 227095Help
Entry
227095            CDS       T01002                                 

Gene name
Hibch, 2610509I15Rik, AI648812
Definition
3-hydroxyisobutyryl-Coenzyme A hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    227095 (Hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    227095 (Hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    227095 (Hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    227095 (Hibch)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     227095 (Hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C1.1; 1
AA seq 385 aa AA seqDB search
MGQPYAWRLLSRVSSFRRASVILQHLRMSMHTEAAEVLLERRGCGGVITLNRPKFLNALS
LNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKARQNLTQDLFREE
YILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGG
YFLPRLQGKLGYFLALTGYRLKGRDVHRAGIATHFVDSEKLRVLEEELLALKSPSAEDVA
GVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQIIENLRQDGSPFAIEQMKVINK
MSPTSLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGHDFHEGVRAVLIDKDQTPKWKP
ANLKDVTDEDLNSYFKSLGSSDLKF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggggcagccatatgcgtggcggctcctgtcgagggtcagctccttcagaagagccagc
gttattctgcaacatctgagaatgtccatgcacacagaagctgcagaagtgctgctggag
aggagaggctgtggaggcgtcataacgctcaacagacccaagttcctcaacgcactgagt
ctgaatatgatccggcagatctatccacagctaaagacatgggaacaagaccctgacaca
ttcctgatcatcataaagggagccggaggaaaggccttctgtgctggaggggacatcaaa
gcactctcagaagctaaaaaagcaagacagaatttaactcaagatttattcagagaagaa
tacatcttgaacaatgcaattgcatcttgtcagaaaccatatgttgcccttattgatgga
atcacaatgggtgggggagttggtctttcagtccatggtcaattccgagtggctacagaa
aggtctctctttgctatgccagaaacgggaataggactatttcctgatgtgggtggaggt
tatttcttgccaagacttcaaggaaaactcggttacttccttgcactgacaggatacaga
ctaaagggaagagatgtgcacagagcgggaattgccacacactttgtagattcggaaaag
ttgcgtgtgttggaggaggagctgttagccttaaagtcaccttcagctgaggatgttgca
ggtgtcttagaaagctatcatgccaagtccaagatggatcaagacaaatctatcatattt
gaggaacacatggacaaaataaacagttgtttttcagccaataccgtggaacagataatt
gaaaacttacggcaagatgggtcaccttttgccatagaacagatgaaggtaattaataaa
atgtctccgacatcactaaagatcacactaaggcaactcatggagggctcttcaaagact
ttgcaagaggtactgatcatggaatatcggataactcaagcatgtatggaagggcatgac
tttcatgaaggtgttagagctgttctcattgacaaagaccagactccaaaatggaaacca
gccaatctaaaagatgttacggatgaagacttgaatagttactttaaatctctgggaagc
agtgatttgaaattctaa

DBGET integrated database retrieval system