KEGG   Mus musculus (mouse): 227095Help
Entry
227095            CDS       T01002                                 

Gene name
Hibch, 2610509I15Rik, HIBYL-COA-H
Definition
(RefSeq) 3-hydroxyisobutyryl-Coenzyme A hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    227095 (Hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    227095 (Hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    227095 (Hibch)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     227095 (Hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C1.1
AA seq 385 aa AA seqDB search
MGQPYAWRLLSRVSSFRRASVILQHLRMSMHTEAAEVLLERRGCGGVITLNRPKFLNALS
LNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKARQNLTQDLFREE
YILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGG
YFLPRLQGKLGYFLALTGYRLKGRDVHRAGIATHFVDSEKLRVLEEELLALKSPSAEDVA
GVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQIIENLRQDGSPFAIEQMKVINK
MSPTSLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGHDFHEGVRAVLIDKDQTPKWKP
ANLKDVTDEDLNSYFKSLGSSDLKF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggggcagccatatgcgtggcggctcctgtcgagggtcagctccttcagaagagccagc
gttattctgcaacatctgagaatgtccatgcacacagaagctgcagaagtgctgctggag
aggagaggctgtggaggcgtcataacgctcaacagacccaagttcctcaacgcactgagt
ctgaatatgatccggcagatctatccacagctaaagacatgggaacaagaccctgacaca
ttcctgatcatcataaagggagccggaggaaaggccttctgtgctggaggggacatcaaa
gcactctcagaagctaaaaaagcaagacagaatttaactcaagatttattcagagaagaa
tacatcttgaacaatgcaattgcatcttgtcagaaaccatatgttgcccttattgatgga
atcacaatgggtgggggagttggtctttcagtccatggtcaattccgagtggctacagaa
aggtctctctttgctatgccagaaacgggaataggactatttcctgatgtgggtggaggt
tatttcttgccaagacttcaaggaaaactcggttacttccttgcactgacaggatacaga
ctaaagggaagagatgtgcacagagcgggaattgccacacactttgtagattcggaaaag
ttgcgtgtgttggaggaggagctgttagccttaaagtcaccttcagctgaggatgttgca
ggtgtcttagaaagctatcatgccaagtccaagatggatcaagacaaatctatcatattt
gaggaacacatggacaaaataaacagttgtttttcagccaataccgtggaacagataatt
gaaaacttacggcaagatgggtcaccttttgccatagaacagatgaaggtaattaataaa
atgtctccgacatcactaaagatcacactaaggcaactcatggagggctcttcaaagact
ttgcaagaggtactgatcatggaatatcggataactcaagcatgtatggaagggcatgac
tttcatgaaggtgttagagctgttctcattgacaaagaccagactccaaaatggaaacca
gccaatctaaaagatgttacggatgaagacttgaatagttactttaaatctctgggaagc
agtgatttgaaattctaa

DBGET integrated database retrieval system