KEGG   Mus musculus (mouse): 227095Help
Entry
227095            CDS       T01002                                 

Gene name
Hibch, 2610509I15Rik, AI648812
Definition
3-hydroxyisobutyryl-Coenzyme A hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mmu01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmu00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mmu00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mmu00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C1.1; 1
AA seq 385 aa AA seqDB search
MGQPYAWRLLSRVSSFRRASVILQHLRMSMHTEAAEVLLERRGCGGVITLNRPKFLNALS
LNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKARQNLTQDLFREE
YILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGG
YFLPRLQGKLGYFLALTGYRLKGRDVHRAGIATHFVDSEKLRVLEEELLALKSPSAEDVA
GVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQIIENLRQDGSPFAIEQMKVINK
MSPTSLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGHDFHEGVRAVLIDKDQTPKWKP
ANLKDVTDEDLNSYFKSLGSSDLKF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggggcagccatatgcgtggcggctcctgtcgagggtcagctccttcagaagagccagc
gttattctgcaacatctgagaatgtccatgcacacagaagctgcagaagtgctgctggag
aggagaggctgtggaggcgtcataacgctcaacagacccaagttcctcaacgcactgagt
ctgaatatgatccggcagatctatccacagctaaagacatgggaacaagaccctgacaca
ttcctgatcatcataaagggagccggaggaaaggccttctgtgctggaggggacatcaaa
gcactctcagaagctaaaaaagcaagacagaatttaactcaagatttattcagagaagaa
tacatcttgaacaatgcaattgcatcttgtcagaaaccatatgttgcccttattgatgga
atcacaatgggtgggggagttggtctttcagtccatggtcaattccgagtggctacagaa
aggtctctctttgctatgccagaaacgggaataggactatttcctgatgtgggtggaggt
tatttcttgccaagacttcaaggaaaactcggttacttccttgcactgacaggatacaga
ctaaagggaagagatgtgcacagagcgggaattgccacacactttgtagattcggaaaag
ttgcgtgtgttggaggaggagctgttagccttaaagtcaccttcagctgaggatgttgca
ggtgtcttagaaagctatcatgccaagtccaagatggatcaagacaaatctatcatattt
gaggaacacatggacaaaataaacagttgtttttcagccaataccgtggaacagataatt
gaaaacttacggcaagatgggtcaccttttgccatagaacagatgaaggtaattaataaa
atgtctccgacatcactaaagatcacactaaggcaactcatggagggctcttcaaagact
ttgcaagaggtactgatcatggaatatcggataactcaagcatgtatggaagggcatgac
tttcatgaaggtgttagagctgttctcattgacaaagaccagactccaaaatggaaacca
gccaatctaaaagatgttacggatgaagacttgaatagttactttaaatctctgggaagc
agtgatttgaaattctaa

DBGET integrated database retrieval system