KEGG   Mus musculus (mouse): 227289Help
Entry
227289            CDS       T01002                                 

Gene name
Gpbar1, BG37, GPCR, GPR131, M-BAR, TGR5
Definition
(RefSeq) G protein-coupled bile acid receptor 1
  KO
K08400  
G protein-coupled bile acid receptor 1
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Lipid
   Bile acid
    227289 (Gpbar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C3; 1 38.53 cM
AA seq 329 aa AA seqDB search
MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAG
LLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPH
GSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGAT
ALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYV
ATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRV
LRGRAKRDNPGPSTAYHTSSQCSIDLDLN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatgacacccaacagcactgagctgtcggccattcccatgggggttctggggctttcc
ttggccctggcaagcctcatcgtcatcgccaacctgctcctggccctaggcatcgccctg
gaccgccacttgcgcagcccacctgctggctgcttcttcctaagcctactactagccggg
ctgctcacagggctggcactgcccatgctgcctgggctatggagccggaaccatcagggc
tactggtcctgcctccttctccacttgacccccaacttttgtttcctttccctgcttgcc
aatctgctgctggtgcatggggaacgctacatggcagtgttgcagccactccggccccat
ggaagtgtgcggctagccctgttcctcacctgggtcagctccctgttctttgccagcctg
cctgctctgggctggaaccattggagccctgatgccaactgcagctcccaagctgtcttc
ccagccccctacctctacctggaagtttatggcctcctgttgcctgccgtgggggccact
gcccttctctctgtccgcgtgttggccactgcccaccgccagctgtgtgagatccgccga
ctggagcgggcagtgtgccgcgatgtaccctcaaccctggctagggctctcacctggagg
caggctagggcacaggcaggagccacactgctcttcttgctgtgttgggggccctatgtg
gccacattgctcctgtcagtcttggcctatgagcgtcgcccaccactagggcctggaact
ctgttatcgctcatctcattgggcagcaccagtgctgccgctgtgcctgtggccatgggg
ctgggtgatcagcgctacacagccccctggaggacagctgcccaaaggtgtctacgagtg
cttcgaggaagagccaagagggacaatccaggccccagcactgcctaccacaccagtagc
caatgcagcattgacctggacttgaattag

DBGET integrated database retrieval system