KEGG   Mus musculus (mouse): 227334Help
Entry
227334            CDS       T01002                                 

Gene name
Usp40, B230215L03Rik, C730029K03
Definition
(RefSeq) ubiquitin specific peptidase 40 (EC:3.4.19.12)
  KO
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     227334 (Usp40)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   227334 (Usp40)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    227334 (Usp40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 D
AA seq 1235 aa AA seqDB search
MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRNQGGTCYLSSLLQTLH
FTPEFREALFSLGPEELGSLEDKDKPDAKVRIIPLQLQRLFAQLLLLDQEAASTIDLTDS
FGWTNDEEMRQHDVQELNRILFSALETSLVGTSGHDLIHRLYHGTIVNQIVCKECKNISE
RQEDFLDLTVAVKNVSGLEDELCNMYVEEEIFDYDNLYHCGTCDRLVKAAKSAKLRKLPP
FLTISLLRFNFDFVKCERYKDTSCYTFPLRINLKPFCEQSELDDMEYMYDLFSVIIHKGG
CYGGHYHVYIKDVDHLGNWQCQEEISDTNVNVKAPQSEEEANDPLVVLKTILLQEEANQI
PVDQLGQKLLKKTGISWNKKYRKQHGPLRKFLQLHPQIFLLSTDESTVSLLRNHLTQAPS
DLQSCEQILHTLASESPGLNDDTSCPHWFDINDSKVHPIREKDITQQFQGKESAYMLFYR
KATLQRPPEARANPRYRVPCHLLKEMDAANILLQMRRAECDSANSTFELHLHLGPHYRFF
NGALHPAVSETESVWDLTFDKRKTLGDLRQSIFQLLECWEGDMVLSVAKRVPAGLHVYHT
LDGDDLTLCEAEVADGEDIFVWNGVEVGGVQIQTGFDCEPLLLNILHLELSGEGSKCEQL
VESPHVFPANAEVGAVFTALGTPAGAILMNSVESADGECWTAVPKEDMKKTFREQGLRNG
SLILVQDSDSDNNSLLPKQGRWTNSMNELNWLQVKNFCQSESEEKQVQIAVTMHTVVFDI
RIKAIKELKLMKELAENSCLRPIDRNGKLLCPVPDSSTLEEAEVKMGSSVGLCLGKAPTS
SQLFLFFALGTDIHPGAEMDIIVEETLSVRDCLKIMLEKSGQQGEIWHLRKMDWCYEAGE
PLCEEDATLKELMIRSGDTLLLTEGKLPPPGHLKMPIWWYQPARLSGHCESRDHLNCAFS
QDSTWRAAPTQGAPGPEPAEVSLLYLGDMEISEEATLVELKSQALALPSVSKLAVQSTAL
LRVWTVESKRPSRLLRTNWRQLKEYRLGRRAELCLELLQKEEDLGPRDVLLRTQLRIPGE
RAYSLATDLIWDTTRGWTAGSLRQRVADFYSLPVEKIEIAKYFPEKFEWLPISSWNQQVA
KRKKKKNQDTLQGGPYYLKDGDTIGIKNLLFDDNDDFSTIRDDIGKENQKRLALEKKKSR
EVHRAQSSDLFSNAGVPARFRGPEASLSIHVASFR
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaacctatttgaagaggattattccagtgtgtcaagtagtcagtatggaaga
gggaagaaattaaagactaaaggtttggagccgcctgcccctagagaattcaccaattta
agtggaatcagaaatcagggtggaacctgttacctcagctcccttcttcagacgcttcat
ttcacacctgaattcagagaagctttattttctcttggtccggaagagctgggttcttta
gaggataaagataaacctgatgcaaaggttcggatcatacctttgcagttgcagcgcttg
tttgcccagcttctgctcttggaccaggaggctgcatctaccatagacctcaccgacagc
ttcgggtggaccaacgatgaggaaatgaggcaacatgatgtgcaggaactcaaccgaatt
ctcttcagtgctttggaaacttctttagttgggacctctggccatgacctcattcatcgt
ctataccatggcaccattgtgaaccagattgtttgcaaagagtgtaagaacatcagtgag
aggcaggaagacttcttggatttgacagtagcagtcaaaaatgtatctggtttagaagat
gaactctgcaacatgtatgtggaggaagaaatttttgactatgacaacctgtaccactgt
ggaacctgtgaccgactggttaaagcagcaaagtctgccaaattgcgtaagctgcctcct
tttcttactatttcattactaagatttaattttgattttgtgaaatgtgaacgctacaag
gatactagctgttatacattccccctccggatcaatctcaagcctttctgtgaacagagt
gaactggatgacatggaatatatgtatgacctcttctccgtcattatccacaaaggtggc
tgctatggaggtcattaccatgtgtacattaaagatgttgatcatcttggcaactggcaa
tgtcaagaggagataagtgatacaaatgtgaatgtgaaagctcctcagagtgaagaagag
gctaatgatccattggtggttctaaaaacaatcttattgcaggaggaggccaatcaaatt
cctgttgatcaactgggccagaaactcttgaaaaaaacaggaatatcttggaacaagaag
tacaggaaacagcatggaccactgcgaaagttcttacagctccatcctcagatatttctg
ctcagcacagatgaaagtacagttagtctcctgaggaaccatcttacccaggccccatct
gacctacagagctgtgaacagattctacatacacttgcttcagaatccccaggcttgaat
gatgacaccagttgcccacactggtttgatatcaatgattccaaagtccatccaatcaga
gagaaagatatcacacagcagttccagggtaaagaaagtgcctacatgctgttttatcgg
aaagccacgttacaaaggccccctgaagctcgagccaatccaagatacagagttccatgt
cacttgctgaaggaaatggatgcagccaacattctactgcagatgagaagggcagaatgt
gactctgcaaacagtacttttgagttgcatcttcatttgggtcctcactaccgtttcttc
aatggggctcttcaccctgcagtctctgagacagaaagcgtgtgggacttaacgtttgat
aaaagaaaaactttaggagatctccgtcagtcaatatttcagctattggaatgttgggaa
ggagacatggttcttagtgttgcgaagcgtgtgccagcaggacttcatgtgtaccacacc
ctcgatggagatgacttgacactgtgtgaagctgaggttgctgatggggaagacatcttt
gtatggaatggggtagaggttggtggagtccaaattcagactggttttgattgtgaacct
ctgctgttaaacattcttcatctagaactaagtggtgaaggctcaaaatgtgagcagttg
gtggagtcaccacatgtctttcctgctaatgcagaagtgggcgctgtgttcacagccttg
ggcaccccagcaggtgccatcctcatgaacagtgtggagtctgcagatggagagtgctgg
actgctgttcccaaagaagacatgaagaagacgttcagagaacaaggtctcagaaatgga
agcttaattttggttcaagattcagacagtgataataacagtctgttgcccaaacaaggg
agatggaccaacagcatgaatgagctcaactggctccaagtgaaaaatttctgccagtca
gaatctgaagagaagcaggttcagatagccgtgaccatgcacacagtggtgtttgatatt
cgaattaaagccataaaggaattaaaattaatgaaggaactagctgagaacagctgtttg
agacccattgatagaaacgggaagcttctttgtccagtcccagacagtagcactttggag
gaagcagaggtgaagatggggagctccgtgggcctgtgtctgggaaaagcaccaacttcc
tctcagctgttcctgttttttgctctggggactgacattcaccctggggcagagatggac
atcatagtagaagaaacactctcagtgagagattgtttaaagataatgctggagaagtca
ggtcagcaaggagagatttggcacttaaggaaaatggattggtgctatgaagctggtgaa
cctttatgtgaagaggatgcaacactgaaagagcttatgatacgttctggggatactttg
cttttaactgaagggaaacttcctcctccgggtcacttgaagatgcccatctggtggtac
cagcctgcaaggctgtcaggacactgtgagagtcgggaccacttaaactgtgccttttct
caagatagcacctggagggctgctcccacccaaggtgctcctggccccgagcctgcagaa
gtctctctcctctacttgggggatatggagatctcagaagaggccacattggtggaactg
aagtctcaggccttggccttgccttctgtttcgaagctcgctgtccagtccacagccctg
ctcagagtctggacagtggagagcaagcgccccagcagactcttgcgcactaactggcgg
cagctcaaggagtacagactgggccggagagcagagctctgcctagagctccttcaaaaa
gaggaggacttggggccccgagatgtactgctgaggacacagctacgcatccctggtgag
agagcctactccctggcgacagacctgatatgggacaccaccagaggatggactgctggc
tccttgaggcagagagtagctgacttctattctcttcctgtggagaaaattgaaattgcc
aaatattttcctgaaaagtttgagtggcttccaatatctagctggaatcagcaagttgcc
aaaagaaaaaagaagaaaaaccaagatactttgcaagggggaccatattacttgaaagat
ggagacactattggcattaagaatctcctgtttgatgacaatgatgatttcagcacaatc
agagatgacattggaaaggagaaccagaagcggctagctttggaaaaaaagaaaagccga
gaagtccaccgtgcacagagcagcgatttgttctccaatgcaggggtgcccgctaggttc
cggggaccagaagcttctctgtccatccacgttgcaagcttcagatag

DBGET integrated database retrieval system