KEGG   Mus musculus (mouse): 227613Help
Entry
227613            CDS       T01002                                 

Gene name
Tubb4b, 4930542G03Rik, Tubb2c, Tubb2c1
Definition
(RefSeq) tubulin, beta 4B class IVB
  KO
K07375  
tubulin beta
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    227613 (Tubb4b)
  Cellular community
   04540 Gap junction
    227613 (Tubb4b)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Other tubulins
     227613 (Tubb4b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    227613 (Tubb4b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   227613 (Tubb4b)
  Exosomal proteins of colorectal cancer cells
   227613 (Tubb4b)
  Exosomal proteins of bladder cancer cells
   227613 (Tubb4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 A3
AA seq 445 aa AA seqDB search
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatcgtgcacctgcaggctgggcagtgcggcaaccagattggcgccaagttc
tgggaggtaatcagcgacgagcatggcattgatcccactggcacttaccacggagatagc
gacctccagctggagcgcatcaacgtgtactacaacgaagccaccggtggcaagtatgtg
ccccgcgccgtgctcgtggacttggagcccggcaccatggactcggtgcgttcagggccc
ttcgggcagatcttcagacctgataacttcgtctttggtcagagtggggctgggaacaac
tgggccaaggggcactacacagaaggtgcagagctggttgactcggtgttggacgttgtg
agaaaggaagctgagagctgtgactgcctgcagggcttccagctgacccactccctgggt
ggggggactgggtctgggatgggtaccctccttatcagcaagatccgggaggagtaccca
gacagaatcatgaacaccttcagtgtggtaccttcccccaaggtgtcggacacagtggtt
gagccctacaatgccaccctttcagtccaccagctggttgaaaacacagatgagacctat
tgtattgataatgaagcactttatgacatctgcttcagaaccctaaagctgaccacaccc
acttacggtgacctgaaccatctagtgtccgccaccatgagtggggtaaccacttgcctg
cgattccctggccagctaaatgctgacctgcggaaactggctgtaaatatggtgcccttc
cctcgcctgcacttcttcatgcctggctttgcccccttgaccagccggggcagccagcag
taccgtgccctgacagttcctgagctcacccagcagatgtttgatgccaagaacatgatg
gctgcctgtgatccaagacatgggcgctacttgactgtggctgccgtgttcaggggccgc
atgtctatgaaggaggtggacgaacagatgcttaatgtccaaaacaagaacagcagctac
tttgttgagtggatccccaacaatgtgaagacagctgtctgtgacattccacctcggggc
ctgaaaatgtcggccaccttcattggcaacagcaccgctattcaggagctgttcaaacgc
atctcagagcagttcacagccatgttccgacgcaaggccttcctacactggtacacgggt
gaaggcatggatgagatggagttcactgaggctgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgctacagctgaggaagagggagagtttgaggaggaggct
gaggaggaggtggcttag

DBGET integrated database retrieval system