KEGG   Mus musculus (mouse): 228357Help
Entry
228357            CDS       T01002                                 

Gene name
Lrp4, 6430526J12Rik, D230026E03, Megf7, mdig
Definition
(RefSeq) low density lipoprotein receptor-related protein 4
  KO
K20051  
low-density lipoprotein receptor-related protein 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 E1; 2 50.63 cM
AA seq 1905 aa AA seqDB search
MRRWWGALLLGALLCAHGIASSLECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDH
SDEDGCTLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG
YCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEE
SCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDS
GLCINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSD
EENCENTGSPQCASDQFLCWNGRCIGQRKLCNGINDCGDSSDESPQQNCRPRTGEENCNV
NNGGCAQKCQMVRGAVQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNTEGAFQCWC
EAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRE
LVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANL
DGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWP
NGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHT
KSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNY
TCACPTGFRKINSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDW
DSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRI
EVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASSRQVIISS
NLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYW
TDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRQRPPVTTLCAVENGGCSHLCLRS
PNPSGFSCTCPTGINLLRDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINMTM
KNTIAIGVDPLEGKVYWSDSTLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYW
TDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGS
DRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERIEVADLNGANRHTLVSPVQHPYGLTL
LDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGC
SHLCLPRPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVP
VPGLNNVISLDYDSVHGKVYYTDVFLDVIRRADLNGSNMETVIGHGLKTTDGLAVDWVAR
NLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERAN
LDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPF
ALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVN
NGGCTHLCFARASDFVCACPDEPDGHPCSLVPGLVPPAPRATSMNEKSPVLPNTLPTTLH
SSTTKTRTSLEGAGGRCSERDAQLGLCAHSNEAVPAAPGEGLHVSYAIGGLLSILLILLV
IAALMLYRHRKSKFTDPGMGNLTYSNPSYRTSTQEVKLEAAPKPAVYNQLCYKKEGGPDH
SYTKEKIKIVEGIRLLAGDDAEWGDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDT
ETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
NT seq 5718 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggtggtggggcgcgctgctgcttggcgccctgctctgcgcacacggaatagcc
agcagtctggagtgtgcatgtggtcggagccacttcacatgtgcggtgagcgcgcttggc
gaatgtacctgtatccccgcccagtggcagtgtgatggagacaatgactgtggagaccac
agcgatgaggatggctgtacgctgcctacctgctcccctctggacttccactgtgacaac
ggcaagtgcatccgacgctcctgggtgtgtgacggggacaatgactgtgaagatgactct
gatgagcaggactgtcccccccgggagtgtgaggaggacgaattcccctgccagaacggc
tactgcattcggagtctgtggcactgtgatggggacaacgactgtggtgacaacagtgac
gagcaatgcgacatgcgcaagtgctcagacaaggaattccgctgcagcgacggcagctgc
attgctgagcattggtactgcgatggtgacacagactgcaaagatggctctgatgaggaa
agctgcccttcagcagtaccctctcctccttgcaacctggaagagttccagtgcgcctat
ggccgctgcatcctcgacatctaccactgtgacggagatgacgactgtggagactggtca
gacgagtctgactgctcctcccaccagccctgccgctctggggaattcatgtgtgacagt
ggcctgtgcatcaactcgggctggcgctgtgatggtgatgcagactgtgatgaccagtct
gatgaacgcaactgcaccacctccatgtgcacagccgaacagtttcgctgtcggtcaggc
cgttgcgtccgtctgtcctggcgctgtgatggggaggatgactgtgcggacaacagcgat
gaagaaaactgtgagaacacaggaagcccccagtgcgcctctgaccagttcctgtgttgg
aacgggcgctgtattgggcagaggaagctgtgcaacgggatcaacgactgcggtgacagc
agtgacgaaagtccacagcagaactgtcggccccggacgggtgaggagaactgcaatgtt
aacaacggtggctgtgcccagaagtgtcagatggtgcgaggggcagtgcagtgtacctgc
cacacaggctaccggctcacagaggatgggagaacgtgccaggatgtaaacgaatgtgct
gaggaggggtactgcagccagggctgcacaaacactgaaggggctttccagtgctggtgt
gaagcagggtatgagctacggcccgatcggcgcagctgcaaagctctggggccagaacct
gtgctactgtttgccaatcgtatcgacatccggcaggtgctcccgcaccgctccgagtac
acgctgctactgaacaacctggagaacgccattgccctcgactttcatcaccggcgggag
ctggtcttctggtcggatgtcaccctggaccgcatcctccgtgccaaccttaatggcagc
aatgtagaggaggtggtgtctactgggctagagagcccagggggcctagcggtggattgg
gtccatgacaagctctactggaccgactctgggacgtcgaggattgaggtggctaatctg
gatggggcccaccggaaggtgctgctatggcagagcctagagaagcccagagccattgcc
ctacaccccatggagggaaccatttattggacagactggggcaacaccccccgcattgag
gcctccagcatggacggctctgggcgtcgcatcattgctgacactcatcttttctggccc
aacggcctcaccatcgactacgctggtcgccgcatgtactgggtggatgctaagcaccac
gtcatcgagagggccaatctagatgggagtcaccgcaaggctgtcattagccagggcctc
ccacatccctttgccatcacagtgtttgaagacagcttgtattggacagactggcacacc
aagagcatcaatagtgccaacaagtttacggggaagaaccaggaaatcattcgcaacaag
ctccactttcctatggacattcataccttgcacccccagcgccagcccgcagggaaaaac
cgctgtggggacaacaatggaggttgcactcacctgtgtctacccagtggccagaactac
acctgtgcctgccccaccggcttccgcaagatcaacagccacgcctgtgcccagagtctt
gacaagttcctgctttttgcccgaaggatggacatccgtcggatcagcttcgacacagag
gacctgtccgacgatgtcatcccactggctgacgtgcgcagtgctgtggcccttgactgg
gactcccgggatgaccacgtgtattggacagatgtcagcactgataccatcagcagggcc
aagtgggatggaacaggacaggaggtggtagtggataccagtttggagagccctgctggc
ctggcaattgattgggtcaccaacaagctctactggacagatgcaggcacggacaggatc
gaagtggccaacacagatggcagcatgaggacagtgctcatctgggagaaccttgaccgt
cctcgggacatagtggtagagcccatgggcgggtacatgtattggactgactggggtgca
agtcccaagattgaacgggctggcatggacgcctccagccgacaagtcatcatctcttcg
aacctgacctggcctaatggattggctattgactacggctctcagcggctgtactgggcg
gatgccggcatgaagactattgaatttgctgggctggatggcagcaagaggaaggtacta
attggaagccagctcccccacccttttgggctgactctatatggacagcgcatctattgg
actgactggcagaccaagagtatacaaagtgctgaccggctgactgggctagaccgggag
actctgcaggagaacctggagaacctcatggacattcatgtcttccaccgccagaggcct
ccagtgacgacgctgtgtgccgtggagaatggcggctgcagccatttgtgtctcaggtcc
ccaaatccgagcggcttcagctgcacctgccccacaggtatcaacctgctacgagatggc
aagacatgctcaccaggcatgaacagtttcctcatcttcgccaggaggattgatgttcgc
atggtctccttggatatcccttattttgctgatgtggtggtacccatcaacatgaccatg
aagaacaccatcgccattggagtggatccgctggaaggaaaagtgtactggtctgacagc
acgctgcacaggatcagccgtgccagcctggatggctcacagcatgaggacatcatcact
acaggtctgcagaccacagacgggcttgcagtggatgccatcggccggaaagtgtactgg
acagacacaggaacgaatcggattgaagttggcaacctggatgggtctatgcggaaagtg
ttggtgtggcagaaccttgacagtccccgggccattgtattataccatgaaatggggttc
atgtactggacagactggggggagaacgccaaattagagcgttccggaatggatggctca
gaccgtactgtgctcatcaacaacaacctagggtggcccaatggactgactgtggacaag
accagttcccaactgctgtgggctgatgcccatactgagagaattgaggtggcagacctg
aatggcgctaatcggcatacactggtgtcaccagtccagcacccatatggcctcactctg
cttgactcctatatctactggactgactggcagacccgcagcatccaccgggccgacaag
agtactggcagcaatgtcatccttgtgaggtccaacctgccaggcctcatggacatccaa
gctgttgaccgggcacagccactgggttttaataaatgtggctcaagaaatggcggctgt
tcccacctctgtttacctcggccttctggtttctcctgtgcctgtcccactggcattcag
ctgaagggagacaggaagacctgtgacccctctccagaaacctacctgctcttctctagc
cgaggctctattcgccgtatctcactggacaccgatgaccacacagacgtgcacgttcct
gttcctgggctcaacaatgtcatctccctagactatgacagtgtgcatggaaaggtctat
tacacagatgtgttcctggatgttatcaggcgagcagacctgaatggcagcaacatggag
actgttattggacacgggcttaagaccactgacgggctggcagtggactgggttgccaga
aacctgtactggacagataccggccgaaataccatcgaagcatctcggctagatggatcc
tgtcgcaaagtgctaatcaacaacagtctagacgagccccgggccattgctgttttcccc
agaaaggggtacctcttctggacagactggggccacattgccaagattgaacgggcaaac
ctggatggctctgagaggaaggtcctcatcaacacagacctaggctggcccaacggcctc
accttggactatgatacccgcaggatctactgggtagatgcacatctggatcggatcgag
agtgctgacctcaatgggaagctgaggcaggtcttggtcagccatgtgtcccaccccttt
gccctcacacagcaggacaggtggatctactggacggactggcagaccaaatcgatccaa
cgtgtcgacaagtactcgggccgcaacaaggagacagtactggccaacgtggagggactt
atggatattattgtggtgtcccctcagcggcagacagggaccaatgcctgcggtgtgaat
aatggtggctgtactcacctctgctttgcccgagcctctgactttgtgtgcgcgtgtcct
gatgagcctgacggtcatccctgctcccttgtacctggcctcgtacctcctgctcccaga
gctaccagcatgaatgagaagagcccagtgctacccaacacgctgcccaccaccttacat
tcttctaccaccaagacccgcacctctctggagggggcaggaggaagatgctctgaaagg
gatgcccagctgggcctctgtgcacattccaatgaagccgtccctgctgctccaggtgaa
ggactgcacgtcagctatgccatcggtggactcctcagtatcctgctgattttgttggtg
atcgcggctttgatgctatacagacacagaaaatccaagttcacggatcctggaatggga
aacctgacctatagcaacccctcctaccgaacttccactcaggaagtgaaacttgaagca
gctcccaagccagccgtgtataatcagctgtgctataagaaagagggtggacctgaccac
agctacaccaaggagaagatcaagattgtagagggaatccgcctcctggctggggatgac
gctgaatggggtgacctcaagcaactgcgcagctccagggggggccttctacgggatcac
gtatgcatgaagacagacacagtgtccatccaggccagctctggctccctagatgacacg
gagacagagcagctgcttcaggaagagcagtctgagtgtagcagtgttcacactgcagcc
actccggagagacggggctctctgccagacacaggctggaaacacgaacgcaagctctcc
tcagaaagccaggtctaa

DBGET integrated database retrieval system