KEGG   Mus musculus (mouse): 229357Help
Entry
229357            CDS       T01002                                 

Gene name
Gpr149, 9630018L10Rik, Ieda, PGR10, R35
Definition
(RefSeq) G protein-coupled receptor 149
  KO
K08433  
G protein-coupled receptor 149
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    229357 (Gpr149)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
3; 3 E1
AA seq 732 aa AA seqDB search
MSFFLSNLTNDSNLWKASHNSTETDLMNSPATLTLSLFCLICIMTLAALVGSIFSLVSLL
TMQYRTVLSILVTSWSVDDLLSVLSVAIFMVLQWPKEAQGYFQSLCTTSALLYMCQGLSS
NLKATLIVCYNFYTMNRTVESQSSSWRLGQVLGVTLTVWAVSLLLASLPLCGWGVFVRTP
WGCLTDCSSPYVLLLFAVYASAFGLLAVLSVPLTHQLLCSEEPLRLHANYQEISRGASTP
GTPAAAGRVLCLPPEDVEIPALRCTGGCSPSSDVVFAPGQPAASGAGAGRRENPGTPQGT
NSFPLSLAQKRFSLILALTKVILWLPMMIHMVVKHVVGFQSLPVDMLSFLLSLLASSVTP
VFVLSKRWAHLPCGCIINCQPDTYSVAFDGKKSKRKGFEFNLSFQQSYGLYKIPHADCYD
DDENSISYHNPKNYECEATKEPWGDNRSVFNTITVEISTTPPLDSATLTGVHKCTNTDIP
ESKQAMKEEKGAFSVKTESDINYGETTSFEGPERRLSHEENQKPDLSDWEWCRSKSERTP
RQRSGGGLAIPICAFQGTVSLQAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGH
EPNSEESPSTFADTSVKIHLEVLEICDNDEALDTVSIISNISQSSTKVRSPSLRYSRKEN
RFVSCDLGETASYSLFLPTSDPDGDINISIPDTVEAHRQNSRRQHEERDGYQEEIQLLNK
AYRKREAESKGD
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctttctcagcaacttaacaaatgactctaacctgtggaaagcaagtcataat
tctacggagacggaccttatgaattcaccagcaactctgactctttctctcttttgcctg
atctgtataatgactctcgcagctctggtgggcagcattttctcactggtttcgctgctg
accatgcaatacagaactgttttgtccatacttgtgacatcttggtctgtggatgatctc
ttgagcgtcttgtccgtggccatcttcatggttttacagtggccaaaagaggcacagggc
tacttccagtctctgtgcaccacctctgccctactgtatatgtgccagggcctctccagc
aacttgaaggcgactctcatagtctgctacaacttttatacgatgaacaggacggtggag
agtcagtcaagctcctggcgattaggacaggtacttggtgtgactttaaccgtttgggca
gtcagcctgctgctggcttcgctcccgctctgtggctggggtgtcttcgtgcgcacgcct
tggggctgcctgaccgactgctccagcccatacgtgctgctcctcttcgcggtatacgct
tccgctttcgggctcctggcggttctctctgtccctctcactcaccagctgctgtgttcg
gaggaaccgctgagactccatgccaactaccaggaaatttctcgtggcgcctctactcct
gggacccctgctgctgcgggaagagtgctctgtctgccgccagaggatgttgagatccct
gctctgcgatgcactgggggatgctccccgagctccgacgtggtgtttgccccgggtcag
ccggctgcctccggcgctggagccggcaggcgagagaatcccgggactccccagggcacc
aacagcttccccttgagcttggcacagaagcgcttttctttgattctagcgctgacgaaa
gtcatcctttggctacccatgatgatccacatggtggtaaaacacgtggtggggtttcag
agccttccggtcgatatgctcagctttctactaagcctgctggccagcagtgtaacacca
gtgtttgtcttatccaaacgttgggcccacttgccttgtggctgcatcatcaactgccag
ccagacacctactccgttgccttcgatgggaaaaagtcgaagaggaaaggctttgaattc
aatctatcattccaacaaagttatggactctataaaataccacatgcagattgctatgat
gatgatgaaaattccatatcctatcacaacccaaagaattatgagtgtgaagctacaaag
gagccttggggagacaaccgcagtgtcttcaataccatcacagtagaaatcagcaccacg
ccaccgctggacagcgccacactgacgggtgtccacaagtgtaccaatactgacatccca
gaatccaaacaggccatgaaagaggaaaagggtgctttttctgttaaaacagaaagcgat
attaactatggagaaaccacctcttttgaaggtccagagagacgactgtcccatgaggag
aatcagaaaccagatctttcagactgggaatggtgcaggagtaagtctgaacgaacgcct
cgccagcgttccggtggtgggctggctattcccatatgcgcgttccaggggactgtgtct
ctccaagcacctactgggaaaacgctctctctttctacttatgaggtcagcgcagaaggg
caaaagataaccccagcctctaagaaaatagaagtctatcgatctaaaagtgttggccat
gaaccgaactcagaggagtctccctccacgtttgcggacaccagtgtaaaaatacacttg
gaagttcttgaaatttgtgacaacgatgaggctctagacactgtgtcaattatcagcaac
atcagccaatcctccacaaaagtcaggtctccttctctgcgctactcacggaaggaaaac
agattcgtctcctgcgacttaggagaaactgcctcatactcgctctttttacccacaagt
gatcctgatggtgatattaacatctctatccctgacacggtggaggcccacagacagaac
agcaggcggcagcatgaagagagggatggctaccaggaagagatccagttgttaaacaaa
gcctacaggaaaagagaggcagaaagcaagggtgattag

DBGET integrated database retrieval system