KEGG   Mus musculus (mouse): 229521Help
Entry
229521            CDS       T01002                                 

Gene name
Syt11, 1500004A13Rik, 3632445O20Rik, 5430404N14Rik, 6530420C11Rik, AI851970
Definition
(RefSeq) synaptotagmin XI
  KO
K19911  
synaptotagmin-11
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F1; 3 38.96 cM
AA seq 430 aa AA seqDB search
MAEITNIRPSFDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKFIHMLK
GISIYPETLSNKKKIIKVRRDKDGPRRESGRGNLLINAESGLLSHDKDPRGPSPASCMDQ
LPIKRDYGEELRSPMTSLTPGESKATSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEA
HGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLV
LHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSY
QPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNE
SFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKP
IAKWHSLSEY
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctgagatcacaaatatacgccccagctttgatgtgtcaccggtagcggctggcctc
atcggggcctccgtgctggtggtgtgtgtttcagtgactgtctttgtgtggacgtgctgc
caccagcaggcagagaagaagcacaagaccccgccatacaagttcattcatatgctgaaa
ggcattagcatctacccagagaccctcagcaacaagaagaaaatcatcaaagttcggaga
gacaaagatggccctcggagggaaagtggacgagggaacctgttaataaacgcggagtct
ggcctgctgagccacgacaaggatcccagagggcctagccctgcatcttgtatggaccag
ttacccatcaaaagagactatggggaagaactgaggagccccatgacaagcctgacccct
ggtgagagcaaagccacctccccatcctcgccagaggaagacgtgatgttaggctctctt
accttctccgtggactacaactttcccaagaaagctctggtggtgacaatccaagaggct
cacgggctgccagtgatggatgaccagacccagggctccgatccctacatcaaaatgacc
attctcccggacaagcggcatcgagtgaagacccgagtgcttcgcaagacgctggacccg
gtgttcgatgagaccttcaccttctacggcatcccgtacagccagctgcaggacctggtg
ctgcatttcctggtgctcagctttgatcgattctctcgggatgacgtcatcggagaggtc
atggtgccattggctggagtggaccccagcacaggcaaggttcagctgaccagggacatc
atcaagaggaacattcagaagtgcattagcagaggggaactccaggtatctctgtcatac
cagcccgtcgcacagagaatgacagtggtggtcctcaaagccagacacttgccgaagatg
gatatcaccggtctctcaggtaatccttatgtcaaggtgaacgtctactacggcagaaaa
cgcattgccaagaagaaaacccatgtaaagaagtgcactttgaaccccgtcttcaatgag
tcgttcatctatgacatccccaccgaccttctgcctgatatcagcatcgagttccttgtc
attgacttcgatcgcactactaagaatgaggtggtagggaggctgatcttgggggcacac
agtgtcacaaccagtggtgcggaacactggagagaggtctgcgagagtccccgcaagccc
atagccaagtggcacagtctgagcgagtactaa

DBGET integrated database retrieval system