KEGG   Mus musculus (mouse): 229697Help
Entry
229697            CDS       T01002                                 

Gene name
Cym, Gm131
Definition
chymosin (EC:3.4.23.4)
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     229697 (Cym)
Peptidases [BR:mmu01002]
 Aspartic Peptidases
  Family A1: pepsin family
   229697 (Cym)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F2.3; 3
AA seq 379 aa AA seqDB search
MRRFVLLLAALAISQSHVVTRIPLHKGKSLRNTLKEQGLLEDFLSRQQYEFSEKNSRIGV
VASEPLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYCNSKVCRNHHRFDPSK
SITFQNLSKPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGLSTQEPGDIFTYSPFDGI
LGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSRNEQGSMLTLGAIDQSYFIGSLHW
VPVTVQGYWQFTVDRITINGEVVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQGH
NDQFDIDCWRLDIMPTVVFEIHGREFPLPPYAYTNQVQGFCSSGFKQGSHMWILGDVFIR
EFYSVFDRANNRVGLAKAI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgctttgtgctgctcctcgctgctctcgccatctcccagagccatgtggtcacc
aggatccccctgcacaaagggaagtctctgaggaacaccctgaaggagcaaggactgctg
gaggactttctgagcagacagcagtacgagttcagtgagaagaactcccgcatcggggtg
gtggccagtgagcctctgatcaactatctagatagtgagtactttggaacgatctacatt
gggacaccaccgcaggagttcaccgtggtgtttgacacaggctcctcagaactctgggta
ccctctgtctactgcaacagcaaagtgtgccgaaaccaccaccgttttgacccatccaag
tccatcaccttccagaacctgagcaagcccctgtttgtccagtatggtactggtagaatg
gagggcttcctggcctacgacactgtcacagtctctgatattgtagtgtcccatcagact
gtgggcctgagtacccaggaaccgggcgacatcttcacctactctccatttgatggcatc
ctgggcctggcctatcctacttttgcctccaaatactcagtacccatatttgacaacatg
atgaacaggcacctggtggcccaagacctgttctccgtttacatgagcaggaatgagcag
gggagcatgctcacactgggggccatcgatcagtcctacttcataggctcactgcactgg
gtgcctgtgacagtacagggatattggcagttcacagtggacaggatcacaatcaatggt
gaagtggtggcttgtcaaggtggctgccctgccgttctggacacaggcactgccctgttg
acggggcctggtagagacatcctcaatattcagcaagtcattggagctgtgcaaggccat
aatgaccagtttgacatcgactgctggaggctggacatcatgcccaccgttgtctttgag
atccatggtagggagttcccactgccaccctacgcttataccaaccaggtccagggcttc
tgctccagtggcttcaagcagggctcccacatgtggatccttggggatgttttcattcgg
gagttctacagtgtgtttgacagagccaacaatcgtgttgggctggccaaggctatctga

DBGET integrated database retrieval system