KEGG   Mus musculus (mouse): 229841Help
Entry
229841            CDS       T01002                                 

Gene name
Cenpe, 312kDa, AU019344, BC049989, C530022J18, CENP-E, Kif10
Definition
centromere protein E
Orthology
K11498  
centromeric protein E
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 H2; 3 62.55 cM
AA seq 2471 aa AA seqDB search
MAEEASVAVCVRVRPLNSREEELGEATHIYWKTDKNAIYQSDGGKSFQFDRVFDSNETTK
NVYEEIAVPIISSAIQGYNGTIFAYGQTASGKTHTMMGSEDCLGVIPRAIHDIFQRIKKF
PEREFLLRVSYMEIYNETITDLLCNAQKMKPLIIREDTNRTVYVSDLTEEVVYTAEMALK
WLATGEKNRHYGITKMNQRSSRSHTIFRMILESREKAEPSNCDGSVKVSHLNLVDLAGSE
RAAQTGAEGVRLKEGCFINRNLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNA
KTRIICTITPASLDETLTTLQFASTAKYMKNTPYVNEVSNDEALLKRYRREIADLRKQLE
EVNTKTRAQEMEKDQLAQLLDEKDLLQKVQDEKINNLKRMLVTSSSIALQQELEIKRKRR
VTWCYGKMKDSNYEKEFKVPTSITTRKRKTSVTSLRENSLMKFGESAASSEFEMLNNTLE
SLAEVEWSSATTLLSEENVESELNSLNAQYNDLVLDYEQLRRENEDLKLKLKEKNELEEF
ELLEQKEERDQEMQLMHEVSNLKNLIKHAEEYNQDLENDLSSKVKLLKEKEEQIKNLQEY
IDAQKSEKMKIDLSYTSDATEDLKQAMRTLSDLDTVALDAKKESAFLRSENLELKEKINE
LSDSRKQMESDIQMYQRQLEAKKKMQTDLDKELQLAFQEISKLSALVDGKGLLSNLELEK
RITDLQKELNKEAEEKQTLQEEVNLLSELKSLPSEVETLRRELYEKSEELHIITTEREKL
FSEMAHKDSRIQGLLEEIGNTRDDLATSQLSRRGSDGEWQALESLHAELEHRHAGVLEER
ERLKQEIGALSKEAESLAFSLDSVKAELSHKTQELEQKTVEGQERLNKMEALREELESRD
SSLQSVEKEKVLLTEKLQQALKEVKALTQEKKNLKQLQESLQTERDQLRSDIQDTVNMNI
DTQEQLLNALESLKQHQETINMLKMKAAEELSDNLHVKDRGGARDEAQQKMDGIDEQNES
AHTLLGGGKDNEVTEEQRKIDSLMQENSGLQQTLESVRAEKEQLKMDLKENIEMSIENQE
ELRILRDELKRQQEVAAQEKDHATEKTQELSRTQERLAKTEEKLEEKNQKLQETQQQLLS
TQEAMSKLQAKVIDMESLQNEFRNQGLALERVETEKLELAQRLHESYEEVKSITKERNDL
KELQESFEIEKKQLKEYAREIEAAGLQTKEELNIAHANLKEYQEIITELRGSISENEAQG
ASTQDTAKSAPELQGEVPEQELLPVVKEARHSAEKVNGLEPVGAHSRTVHSMTMEGIEIE
NLRLTKKLEESQMEISCLTREREDLRRTQETLQVECTQLKEDARRTLANHLETEEELNLA
RCCLKEQENKIDTLITSLSQRETELSSVRGQLALTTAELERKVQELCEKQEELTRKETSE
AQGKMSELEQLRELLLAQASALQNAESDRLRLNTQLEESQEEMKTLREEREELRRMQEAL
HVESEQQKESMKEISSKLQELQNKEYECLAMKTINETQGSRCEMDHLNQQLEAQKSTLEK
VEMENVNLTQRLHETLEEMRSVAKERDELWSMEERLTVERDQLKKSLEETVTKGMEKEEE
LRVAHVHLEEHQETINKLRKMVSDYTDEISHTQGDLKHTNAVVEAQNQDLREKEHQLSQV
KADLRETVDQMEQLKKKLEAQSSTLESREIEKLELTQQLNENLKKITLVTKENDSLKIMD
EALREERDQLRKSLQQTEARDLENQEKLRIAHMNLKEHQETIDRLMETMSEKTEEISNMK
MELENVNMKLQEKVQELKTSERQRVKLKADASEAKKELKEQGLTLSKIEMENLNLAQKIH
ENLEEMKSVRKERDDLKKLEEILRMERDQLKDNLREAMLKAHQNHEETMKCGKGLLCAGE
YCTGRLREKCFRIEKLLKRYSEMANDYECLNKVSLDLERETKTQKELSVTVRTKLSLPHT
QTKEMEKLLTANQRCSLEFHRALKRLKYVLSSIARIKEEQHESINKREMAFIQEVEKQNE
LQIQIQSLSQTYRIPARDLQIKLSQEMDLHIEEMLKDFSENDFLTIKTEVQQVLNNRKEI
TEFLGKWLNTLFDTENLKSTIQKENKSIGLVNNFYHSRITAMINESTEFEERSATRSKDL
DQYLKSLKETTEQLSEVYQTLTASQSVVHLHPTVQPSTRDSERPQAASGAEQLTSKNKIA
LGAVPYKEEIEDLKMQLVKSDLEKKATAKEFDKKILSLKATVEHQEEMIRLLRENLRGHQ
QAQDTSMISEQDSQLLSKPLTCGGGSGIVQSTKALILKSEYKRMGSEISKLKQQNEQLRK
QNNQLLSDNSQLSNEVKTWEERTLKRDSYRETTCENSPKSPKVTRTDSKRRQNTTSQCRA
QNLQDPVPKDSPKSWFFDNRSKSLPAPHPIRYFDNSSLGLCPEPDDVENVEPKTDLCQAS
LEKDVSQCKTQ
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaggcttcagtggctgtctgtgttcgtgtgcgacccctcaacagcagagaa
gaagaacttggagaagccacccacatttactggaaaacagataaaaacgctatttatcag
agcgatgggggtaaatctttccaatttgatcgtgtctttgacagtaatgaaaccacgaag
aatgtgtatgaagagattgcggtgcccatcatcagctccgccatacaaggctacaatggt
actatatttgcctatggacaaactgcatcaggaaagacacacacgatgatgggttctgaa
gattgtttgggagttatacccagggcaattcatgacattttccaaaggataaagaagttt
cctgagagagaatttctcctacgagtttcttacatggagatctacaatgaaaccattaca
gatttactctgtaatgctcaaaaaatgaaacctttgataattcgggaagacaccaatagg
actgtatatgtttctgatctcacagaagaagtggtttatacagcagaaatggctttgaaa
tggctcgcaacaggagaaaaaaacagacattatggaataaccaaaatgaatcaaagaagc
agtcgttctcatacgatttttaggatgattctggaaagtagagaaaaggctgagccttct
aactgcgatggctccgtcaaagtgtctcatctgaatttggtcgatcttgcaggcagtgaa
agagctgctcaaacaggagctgaaggtgtgcgattgaaggagggctgttttataaatcgg
aacttgtttattttgggacaagtgattaagaaactcagtgatggacaggttgggggtttc
ataaattaccgagatagcaaattgacacgaattcttcagaattccttgggaggaaatgcc
aagacgcgcatcatctgcacgatcaccccagcgtccctggacgaaaccctgacgacgctg
cagtttgccagcactgctaagtatatgaagaatactccttacgttaatgaagtgtcgaat
gatgaagctctcttgaaaagatacagaagagaaatagcggatcttagaaaacaattagag
gaggtaaatacaaagactcgggcacaggaaatggaaaaggatcaactggcccagcttctg
gatgaaaaagacttgcttcagaaagttcaggatgagaaaattaataacctgaagcggatg
ctggtgacgtcatcttctattgcattgcagcaggagctagagattaaaaggaaacgaaga
gttacttggtgctatggcaaaatgaaggattcaaactatgaaaaggaatttaaagtcccg
acaagcataacaacaagaaaacgtaaaacttctgtgacttctttgagagaaaattctctc
atgaagttcggagagagtgcagcctcttccgagtttgaaatgttgaataacactcttgag
tcattggctgaggtagagtggagctcggcaacaacgctcctaagcgaggaaaatgtagaa
agtgagttgaactcacttaatgctcaatataatgatctggtattagactatgaacagctc
agaagagaaaatgaagacttgaaattgaaattaaaagaaaaaaatgagttagaggaattt
gagcttctagaacaaaaagaagaaagagatcaagagatgcaactaatgcatgaagtttcc
aacttaaagaatttaattaaacacgcagaagaatataatcaagaccttgagaatgaccta
agttcaaaagtgaagcttcttaaagaaaaagaggagcagattaagaacctgcaggaatac
atagatgcccagaagtcagaaaagatgaagatagacctgtcatacacatcggacgccact
gaagacctgaaacaggcgatgcgcaccctgtctgatttggacacagtggcccttgacgct
aagaaagagtcagccttccttagaagtgaaaatctggagctgaaggagaaaattaatgaa
ctttcggattcccgtaagcaaatggaaagtgacattcagatgtatcaacgccaactggaa
gcaaaaaagaaaatgcaaactgatctggataaggaattacagttggcttttcaagaaata
tcaaaactcagcgccctggtagatggcaaaggtttactgtctaatttggaattggagaaa
aggattactgatctccaaaaagaactaaataaagaagctgaagaaaaacaaactttgcaa
gaagaagttaacttgctgtcggagttgaaatctttaccgtctgaggtggaaacgctgagg
agagagctgtatgagaaatctgaagagctccatataataaccacagaaagagagaaactg
ttttctgaaatggctcataaagacagtaggattcaaggtttacttgaggaaattggaaac
actagagatgaccttgccacttcccagctgagtcggaggggcagtgatggagaatggcaa
gccctggaaagcctgcacgcagagctggagcacagacacgcgggggtcctggaggagaga
gagaggctgaagcaggagattggggctctctccaaagaagcagaaagcctggctttcagt
ttggattccgtgaaggccgagctttctcacaagactcaagagcttgagcagaaaacagtt
gagggtcaagaaaggctaaataaaatggaggcgctgagagaagagttagaaagcagagac
tccagcctgcagtctgtagagaaggagaaagtcctgctcactgagaagctgcagcaagcc
ttgaaggaagtaaaagccttaacccaagaaaagaaaaacctgaagcagctccaggagagc
ctgcaaactgagagagaccaactcagaagtgacattcaggacactgtgaacatgaacata
gatactcaagagcagttactaaatgctctggagtctctgaaacaacaccaagaaacaatt
aacatgctgaaaatgaaagctgctgaggaactatccgataatttgcatgtaaaggacagg
ggaggagctagagatgaagctcagcaaaagatggatggcatagatgaacagaatgagagt
gcccacacattgcttggtggtggtaaggacaatgaggtaactgaggaacagaggaaaatc
gactctctaatgcaggagaatagcggactccaacagacactggaaagtgttagagcagaa
aaggaacaactgaagatggacctaaaggaaaatatcgaaatgagtattgaaaaccaggaa
gagttaagaattcttagagatgaactgaaaagacaacaagaggtagctgcacaggaaaag
gatcatgccaccgagaagacccaggagctctccaggacgcaggaaagattggcaaaaaca
gaagagaagttagaggaaaagaaccagaaactccaagagacacagcagcaacttcttagt
acacaagaagctatgagtaagctgcaggcaaaggtgattgacatggaaagcttacagaat
gaattcaggaaccaaggattggcattggagcgtgtggagacagagaaactggagttagct
cagagacttcatgaaagttatgaggaggtgaaatctataaccaaagaaagaaatgatcta
aaggaattgcaggagtcatttgaaatagagaagaagcaacttaaagaatatgcaagggaa
atagaagccgcgggcctacaaacaaaagaagaactaaacattgcccacgcgaatctaaaa
gagtaccaggaaatcatcacagagctaagaggaagcatttctgaaaacgaagcacaagga
gcaagcacccaggacacggcaaaaagcgcccctgagctacaaggagaggttccagagcaa
gagctgcttcctgttgtcaaagaagccaggcacagtgcagaaaaagtgaacggactggag
ccagtgggagcacattccagaacagtgcactccatgacaatggagggcatagaaatagaa
aacctcaggctgaccaagaaacttgaagaaagtcagatggagatcagctgtctcactaga
gagagagaagacctgagaaggacacaggaaacacttcaggtcgaatgtacccagctgaaa
gaagatgccagaagaactttggctaatcatctagaaactgaagaggaacttaaccttgct
cgttgttgcctgaaagagcaggagaacaagattgacaccctaataacgagcctctcgcag
agggaaactgagctgtccagtgtgcgaggacaactagcgctgactactgctgaactggag
agaaaggttcaagaactctgtgagaaacaggaagaacttactaggaaagaaactagcgag
gctcaagggaagatgagtgaactagagcaactcagggagctgctgcttgcccaggcctcg
gcactgcagaacgcagagagtgacaggctgcggctgaatacacaactggaagaaagtcaa
gaggaaatgaaaactctaagggaggaaagagaagagctgagaagaatgcaagaggctctt
cacgtggaaagtgagcagcagaaagaaagcatgaaggaaatcagctcaaaactccaagaa
ctacagaacaaagagtatgaatgtcttgcaatgaagactattaatgagactcaaggaagc
agatgtgaaatggaccacttgaaccagcagctggaggcccagaagtcaactctggaaaag
gtggagatggagaatgtaaacttgactcaaagacttcatgagacccttgaggaaatgaga
tctgtagcaaaagaaagagatgagctttggagcatggaggagcgcctcacagtagagaga
gaccaactgaagaagagccttgaagaaacagtaactaaaggtatggaaaaagaggaagag
ctaagagttgcgcatgtgcatctggaagagcaccaggaaactatcaacaagctcagaaag
atggtgtctgactacacagatgaaatatcacatactcaaggggacctaaagcacacaaat
gccgttgtagaagctcagaaccaagatctccgggaaaaagaacatcaactttctcaagta
aaagctgatctcagagaaaccgtggatcaaatggagcaactgaagaagaagctcgaagcc
cagagttcgactctagaaagcagagaaatagagaagttagaattgactcagcaacttaac
gaaaaccttaaaaaaataacacttgtcactaaggaaaatgatagcctaaaaattatggat
gaagccctcagggaagaacgagaccagctacggaaaagtcttcagcaaacagaggcaagg
gatctggaaaatcaagagaaactaagaattgctcacatgaatctaaaagagcaccaagaa
actattgaccgactcatggagactatgtctgagaagacagaggaaatatcaaatatgaaa
atggagttagaaaatgtaaacatgaaattacaagaaaaggttcaagaacttaagacaagt
gagcgtcaacgtgttaagttaaaagcagatgccagtgaagccaagaaggagctcaaggag
cagggcttaactctgagtaagatagagatggagaacttaaatctcgctcagaagattcat
gagaaccttgaagaaatgaaatctgtaagaaaagaaagagatgatctaaagaaacttgag
gagatactcagaatggagagagaccagctcaaggacaacctgagagaagccatgcttaag
gcccaccagaaccatgaagagacaatgaaatgtggaaaggggttactgtgtgctggagaa
tactgtacaggaagacttcgagaaaagtgcttcaggatagaaaaactcctgaaaagatac
tcagaaatggctaatgattatgagtgcttgaataaagtctctcttgacttggagagagaa
actaaaacccaaaaagagctgtcagttactgtaagaacaaagctctcacttccgcacaca
cagaccaaagagatggaaaagcttctgactgcaaaccagagatgttccctggagttccac
agagccctcaagagacttaagtacgtgttaagctccattgcgaggataaaggaagagcag
catgagtccatcaataaacgtgaaatggcttttattcaggaagtggaaaagcagaatgaa
ctgcagattcaaatccagagcctttcacagacttaccgtattccagccagagacttacag
atcaaactgagccaggagatggacctccatattgaggaaatgctcaaagatttttcagaa
aatgatttcctcaccataaaaactgaagtccaacaagtattaaataataggaaagaaata
actgagtttttgggaaaatggctaaatactctttttgatacagaaaatcttaagagcacc
atccagaaagaaaacaaaagcattgggctcgtgaataacttctatcacagcagaatcact
gccatgataaatgaatcaacggagtttgaggaaagaagtgctaccagatccaaagacttg
gatcagtacctgaagtcactgaaagaaacaactgagcaactgtctgaagtctaccagaca
ctgaccgcctcccagtctgttgtgcatctccatcctaccgtgcagccttccacacgggac
agtgagcgtcctcaggctgcatcaggagctgaacaactgacctcaaagaacaaaattgct
ttaggagctgtgccctataaagaagaaattgaggatctcaaaatgcagctggtgaagagt
gacctagagaagaaggcgaccgccaaggaattcgataagaaaattctctctctaaaagcc
actgttgaacatcaagaagaaatgataaggctactgagagaaaatcttagaggacatcaa
caggcccaggatacctcaatgatctcagaacaagactctcagcttctgagtaaacctcta
acctgtggaggtggcagtggaattgtacaaagcacaaaagctcttattttgaaaagtgaa
tataaaaggatgggaagtgagatttctaagttaaagcagcaaaatgagcagctaagaaag
caaaataatcaactattaagtgataactctcaactctccaatgaggttaaaacctgggag
gaaagaactcttaaaagagacagttacagagaaacaacttgtgagaattctccaaagtct
cctaaagtgactcggacagattctaaaaggagacagaacacaacttctcagtgcagggca
caaaatctccaggatcctgtgccaaaagattccccaaaatcatggttttttgataaccgg
tcaaagtctcttccagcacctcacccgatccgctattttgacaactccagtctagggctg
tgcccagaaccagatgacgtagagaatgtggagcctaagacagacctctgccaagcctcc
ttggaaaaagatgtgtcccagtgcaagacgcagtag

DBGET integrated database retrieval system