KEGG   Mus musculus (mouse): 230484Help
Entry
230484            CDS       T01002                                 

Gene name
Usp1
Definition
ubiquitin specific peptidase 1 (EC:3.4.19.12)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    230484 (Usp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     230484 (Usp1)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   230484 (Usp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C6; 4
AA seq 784 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKTSEYRGSEIDQV
VPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKTGVKHLFNIISRKK
EALKDDSNQKDKGSCKEESLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGFLQHDAQEVLQCILGNIQETCQLLKKEEIKNLAELSGKVEEQSLQK
EETGGITSTEIDSMRNTEDVKEQLPKGNWKRKSDSESSNVKKKVKLSRESQPLEENQRQT
RSKRKAIGDTLEAAPKIIPKCVSESESAKPSQKKSKVKINWLKPSTKQPSILSKFCSLGK
ITTNQRSKGQPKEKEGDVEEDLEKYGSDHTANGGPESPGSSVTPVDSSEAKSGNKGAEQI
GFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTE
MKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLE
FDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVT
DLNSLELDEGNFVVDQMCELGKPEPLTEEQARGTAGNYDDEVSIRVGGNAQPSKVLNKKN
VEGIGLLGGQKSKADYELYNKASNPDKVVGTPFTDNRNSETNDTTNGTHESDRNKESSDQ
TGVNMNGLENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgtcatacctagtgaaagtaatgggctttcaagaggcagtccatccaagaaa
aacagactgtctctgaagttttttcagaaaaaggaaactaaaagagccttagactttact
gattctcaagaaaatgaagaaaaaacttctgaatatagaggatctgagattgaccaagtt
gttcctgctgcacagtcctccccagtaagctgcgagaagagagagaacttgttaccattt
gtgggattgaataaccttggcaacacttgttatctgaatagtattcttcaggtgttatac
ttttgtcctggctttaagactggagtgaagcacttatttaatattatttcaaggaagaaa
gaagctctgaaggatgactctaatcagaaggataagggaagctgcaaagaagagtctttg
gcaagttatgagcttatatgtagtttacagtccttaataatttcagttgaacagcttcag
gctagttttctcttaaatccagagaaatatacagatgaacttgctacacagccaaggcga
ctgctgaacacactcagggaactcaaccctatgtatgaaggatttctacagcatgatgca
caggaagtgctacagtgtattctgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaaataaaaaacctggctgaattatccggcaaggttgaagaacaatctcttcagaaa
gaggaaacaggtggaattaccagcacagagattgacagtatgaggaatacggaggacgtc
aaagagcagctccccaaagggaactggaaaagaaaaagtgacagtgagtcgagtaacgtg
aagaaaaaggttaaactgtccagggaatcccagccattggaagaaaaccagagacaaacc
agatccaagagaaaagctatcggagacacactagaggctgctcctaagatcatccccaag
tgtgtttctgaaagtgagagtgcaaagccctcacagaagaaatcaaaagttaaaataaat
tggttaaagccatccactaagcaacccagcattctttccaagttctgtagtcttggaaaa
ataacaactaaccagcgctccaaaggacaacctaaggaaaaggagggtgatgttgaagag
gacttggagaagtacggaagtgaccacacagctaatggtggacccgaatctccaggaagt
agcgtcacacctgtggacagcagtgaagccaagtccggaaacaaaggtgctgaacagatt
ggctttgagctagtagagaaactgtttcaaggtcagctcgtgttaaggactcggtgtttg
gaatgtgaaagcttaacagaaagaagagaagatttccaggatattagtgttccagtgcaa
gaagatgagctttccaaggtcgaggagagctctgaaatttctccagagccaaaaacagaa
atgaagaccttgagatgggcaatttcacagtttgcttcagtggagagaattgtaggagag
gataaatacttctgtgaaaattgccatcattatacggaagcagagcgaagtctcctgttt
gataaaatgcctgaagttatcactattcatctgaagtgctttgctgctagtggcttggag
tttgactgttacggtggtggactttccaagatcaacactcctttattgacacctcttaaa
ctgtcactagaagaatggagcacaaagccgacgaatgacagctatggattatttgccgtt
gtgatgcacagtggcattactattagtagtgggcactataccgcatctgttaaagtcact
gaccttaacagtctagagctcgatgaggggaattttgtggttgaccagatgtgtgaacta
ggtaagccagagccactgaccgaggagcaagcaagggggacggctgggaactacgacgat
gaagtatcaattagagttggtggaaatgcccagccaagtaaagttttgaacaaaaaaaat
gtagaaggtattggacttctcggtggacaaaagagcaaagcagattatgagctgtacaac
aaagcatctaatcctgataaggtggttgggacaccattcaccgacaatagaaattctgaa
actaatgatactactaatgggacccacgaatctgacaggaacaaggaatccagtgaccaa
acaggcgttaacatgaacggacttgagaacaaaatttcctatgtagtgcaaagcttaaag
gagtacgaggggaagtggttgctctttgacgattctgaggtaaaagtgacagaagagaaa
gactttctgaattctctctccccttctacatcccctacgtctactccctacttgctattc
tataaaaaattatag

DBGET integrated database retrieval system