KEGG   Mus musculus (mouse): 230484Help
Entry
230484            CDS       T01002                                 

Gene name
Usp1
Definition
ubiquitin specific peptidase 1 (EC:3.4.19.12)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:mmu03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C6; 4
AA seq 784 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKTSEYRGSEIDQV
VPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKTGVKHLFNIISRKK
EALKDDSNQKDKGSCKEESLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGFLQHDAQEVLQCILGNIQETCQLLKKEEIKNLAELSGKVEEQSLQK
EETGGITSTEIDSMRNTEDVKEQLPKGNWKRKSDSESSNVKKKVKLSRESQPLEENQRQT
RSKRKAIGDTLEAAPKIIPKCVSESESAKPSQKKSKVKINWLKPSTKQPSILSKFCSLGK
ITTNQRSKGQPKEKEGDVEEDLEKYGSDHTANGGPESPGSSVTPVDSSEAKSGNKGAEQI
GFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTE
MKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLE
FDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVT
DLNSLELDEGNFVVDQMCELGKPEPLTEEQARGTAGNYDDEVSIRVGGNAQPSKVLNKKN
VEGIGLLGGQKSKADYELYNKASNPDKVVGTPFTDNRNSETNDTTNGTHESDRNKESSDQ
TGVNMNGLENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgtcatacctagtgaaagtaatgggctttcaagaggcagtccatccaagaaa
aacagactgtctctgaagttttttcagaaaaaggaaactaaaagagccttagactttact
gattctcaagaaaatgaagaaaaaacttctgaatatagaggatctgagattgaccaagtt
gttcctgctgcacagtcctccccagtaagctgcgagaagagagagaacttgttaccattt
gtgggattgaataaccttggcaacacttgttatctgaatagtattcttcaggtgttatac
ttttgtcctggctttaagactggagtgaagcacttatttaatattatttcaaggaagaaa
gaagctctgaaggatgactctaatcagaaggataagggaagctgcaaagaagagtctttg
gcaagttatgagcttatatgtagtttacagtccttaataatttcagttgaacagcttcag
gctagttttctcttaaatccagagaaatatacagatgaacttgctacacagccaaggcga
ctgctgaacacactcagggaactcaaccctatgtatgaaggatttctacagcatgatgca
caggaagtgctacagtgtattctgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaaataaaaaacctggctgaattatccggcaaggttgaagaacaatctcttcagaaa
gaggaaacaggtggaattaccagcacagagattgacagtatgaggaatacggaggacgtc
aaagagcagctccccaaagggaactggaaaagaaaaagtgacagtgagtcgagtaacgtg
aagaaaaaggttaaactgtccagggaatcccagccattggaagaaaaccagagacaaacc
agatccaagagaaaagctatcggagacacactagaggctgctcctaagatcatccccaag
tgtgtttctgaaagtgagagtgcaaagccctcacagaagaaatcaaaagttaaaataaat
tggttaaagccatccactaagcaacccagcattctttccaagttctgtagtcttggaaaa
ataacaactaaccagcgctccaaaggacaacctaaggaaaaggagggtgatgttgaagag
gacttggagaagtacggaagtgaccacacagctaatggtggacccgaatctccaggaagt
agcgtcacacctgtggacagcagtgaagccaagtccggaaacaaaggtgctgaacagatt
ggctttgagctagtagagaaactgtttcaaggtcagctcgtgttaaggactcggtgtttg
gaatgtgaaagcttaacagaaagaagagaagatttccaggatattagtgttccagtgcaa
gaagatgagctttccaaggtcgaggagagctctgaaatttctccagagccaaaaacagaa
atgaagaccttgagatgggcaatttcacagtttgcttcagtggagagaattgtaggagag
gataaatacttctgtgaaaattgccatcattatacggaagcagagcgaagtctcctgttt
gataaaatgcctgaagttatcactattcatctgaagtgctttgctgctagtggcttggag
tttgactgttacggtggtggactttccaagatcaacactcctttattgacacctcttaaa
ctgtcactagaagaatggagcacaaagccgacgaatgacagctatggattatttgccgtt
gtgatgcacagtggcattactattagtagtgggcactataccgcatctgttaaagtcact
gaccttaacagtctagagctcgatgaggggaattttgtggttgaccagatgtgtgaacta
ggtaagccagagccactgaccgaggagcaagcaagggggacggctgggaactacgacgat
gaagtatcaattagagttggtggaaatgcccagccaagtaaagttttgaacaaaaaaaat
gtagaaggtattggacttctcggtggacaaaagagcaaagcagattatgagctgtacaac
aaagcatctaatcctgataaggtggttgggacaccattcaccgacaatagaaattctgaa
actaatgatactactaatgggacccacgaatctgacaggaacaaggaatccagtgaccaa
acaggcgttaacatgaacggacttgagaacaaaatttcctatgtagtgcaaagcttaaag
gagtacgaggggaagtggttgctctttgacgattctgaggtaaaagtgacagaagagaaa
gactttctgaattctctctccccttctacatcccctacgtctactccctacttgctattc
tataaaaaattatag

DBGET integrated database retrieval system