KEGG   Mus musculus (mouse): 230661Help
Entry
230661            CDS       T01002                                 

Gene name
Tesk2
Definition
testis-specific kinase 2 (EC:2.7.12.1)
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     230661 (Tesk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   230661 (Tesk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D1; 4
AA seq 570 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEEFEGGGGGDGNTVQVGRVSSSSYRAIISAFSRLTSLDDFT
REKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANLLKEMQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSDLYLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDASIGREKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQNMVGDCPSDFLQLTFNCCNMDPKLRP
SFEEIGKTLKEIMSRLPEEELERDRKLQPTAKGPLEKVPGGKRLSSLDDKIPHKSPRPRR
TIWLSRSQSDIFSHKPPRTVSVLDPYYQPRDGATHTPKVNPFSARQDLKGGKVKFFDLPS
KSVISLVFDLDAPGPGSTTLADCQEPLAMSSRRWRSLPGSPEFLHQACPFMGCEESLSDG
PPPRLSSLKYGVREIPPFRTSALSAASGHEAMDCSNPQEENGFGPRLKGTSLCTGAASEE
MEVEEERPRRASVYFSISGISLQTQAKQDG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaagcggaactcaattgcagggtttcccccacgtgtggagcgtctggaa
gaatttgaaggaggtggtggaggggatgggaacactgtgcaggtgggaagagtttcatca
tcttcatatcgtgcgattattagtgccttttccagactgacgagtttggatgacttcacc
cgtgaaaaaataggatctgggttcttctccgaagtgttcaaggtgcgacacagagcttct
ggtcaggtgatggctctcaagatgaacacgctgagcagtaaccgagcaaacctgctgaaa
gagatgcagctcatgaatagactctcccaccccaacatcctcaggttcatgggtgtatgt
gtacatcaaggacagttgcatgcacttacagagtatatcaactctgggaacctggagcag
ctgctggacagtgacttgtatttaccgtggactgtgagagtgaaactggcctatgacata
gcagtgggcctcagctaccttcacttcaaaggcattttccatcgggacctcacatcaaag
aactgcctgataaagagagatgaaaacggttactctgctgtggtagctgacttcggcctg
gctgagaagatccctgacgctagtatagggagggagaagctagctgtggtgggctcgcct
ttctggatggcacctgaggttctccgagatgagccttataatgagaaggcagatgtcttc
tcttatggtatcatcctctgcgagatcatcgcccgcattcaggctgatccggactatctt
ccccgcacagagaatttcgggctggattacgatgctttccagaacatggtgggagactgc
ccctcagacttcctgcagctcacctttaactgctgtaatatggaccccaaactgcgccca
tcctttgaggagattgggaagaccctaaaggaaattatgagccgcttaccggaagaagag
ttggagagagataggaagctacagcccacagctaaaggaccactggagaaagtgcctgga
gggaagcgactgagttcactggatgacaagattccccacaagtctccacgtccaagacgt
actatctggctgtctcgaagccagtcagatattttttctcataagcccccacgtacagtc
agtgtcttggacccctattaccagccacgagatggtgctacacataccccaaaagtcaac
cctttcagtgcacgccaagacctcaagggcgggaaggtcaaattctttgacctacccagc
aaatctgtcatttcccttgtatttgacctggatgcaccggggcctggaagtacaactctg
gctgactgtcaggagcctttggccatgtcttccagacggtggcggtctttgcctggttca
cctgagttcttgcatcaggcttgtccatttatgggctgtgaagaatcactctctgatggg
cctccaccacgactcagtagtctcaagtacggagtaagagagatcccaccattccggaca
tctgccctatcagctgcttcaggccacgaggccatggactgctctaacccccaagaagag
aacggttttggacccaggcttaaggggaccagcctatgcactggggctgcctctgaggag
atggaggtggaagaggaaaggccacgaagagcttctgtctacttctctatctctggaata
agcttgcaaacccaggcaaagcaggatgggtga

DBGET integrated database retrieval system