KEGG   Mus musculus (mouse): 231396Help
Entry
231396            CDS       T01002                                 

Gene name
Ugt2b36
Definition
UDP glucuronosyltransferase 2 family, polypeptide B36 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    231396 (Ugt2b36)
   00053 Ascorbate and aldarate metabolism
    231396 (Ugt2b36)
   00500 Starch and sucrose metabolism
    231396 (Ugt2b36)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    231396 (Ugt2b36)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    231396 (Ugt2b36)
   00860 Porphyrin and chlorophyll metabolism
    231396 (Ugt2b36)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    231396 (Ugt2b36)
   00982 Drug metabolism - cytochrome P450
    231396 (Ugt2b36)
   00983 Drug metabolism - other enzymes
    231396 (Ugt2b36)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    231396 (Ugt2b36)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     231396 (Ugt2b36)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   231396 (Ugt2b36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 E1; 5
AA seq 530 aa AA seqDB search
MLWKWISALLLLQISCCFRSAKCGKVLVWPVDYSHWMNIKIILDELKQKGHEVTVLRPST
SIFLDPKKSPGLKFETFPTSFSNDVMEIIFAKAVERWTYEVPRDTCLSYSPLLQNIFDEY
SDYCLTLCKDTVSNKQLMAKLQESKFDVILSDAIGPCGELIAELLQIPFLYSLRFSPGYY
LEKYSGGLPLPPSYVPVILSGLSGQMTFKERVKNMICMLYFDFWFQTFREKKWDQFYSET
LGRPTTLIETMGKAEMWLIRSYWDLEFPHPTLPNVYYVGGVHCKPAKPLPKEMEDFVQSS
GEHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWRFDGKTPATLGPNTRIYKWLPQ
NDLLGHPKTKAFITHGGANGLYEAIHHGIPMIGIPLFGEQHDNIAHMVAKGAAVTLNIRT
MSRSDLLNALEEVIDNPFYKENAMWLSTIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRPL
AYNLTWYQYHSLDVIGFLLAFVTFIVALIVKCFLFVYRFFVKKEKKMKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctttggaagtggatttctgctctgctgctgctgcagataagttgctgcttcagatct
gcaaagtgtgggaaggtgttggtatggccggtggactacagtcactggatgaatataaag
ataatactggatgaacttaaacagaagggccatgaagtcactgttttgagaccttcaact
tccatttttcttgatcccaaaaaatcgcctggccttaagtttgaaacttttcctacatct
ttcagtaatgatgtcatggaaattatttttgcaaaggctgtggaaagatggacttatgag
gttccaagagatacatgtttatcatattctcctttattacaaaatatatttgatgaatat
tctgattactgtttaactctttgcaaagacacagtttcaaacaaacagctcatggcaaaa
ctccaggaatccaagtttgatgtcattttgtcagatgctattggtccctgtggggagctc
atagctgaactgctccaaattccttttctatatagtcttcgcttctctcctggctactat
cttgaaaaatacagtggaggactccctctccctccctcttatgtacctgtaattttgtca
ggattaagtggtcaaatgacattcaaagagagggtaaagaatatgatatgtatgctttat
tttgacttttggttccagacatttagggagaagaaatgggatcagttttacagcgaaact
ttgggaaggccaaccaccttaattgagacaatgggcaaagcagaaatgtggctcattaga
tcctattgggatttggagtttcctcacccaaccttaccaaatgtttactatgttggagga
gtccattgcaaacctgctaaaccattgcctaaggaaatggaagactttgttcagagctct
ggagagcatggtgtggtggtgttttctctggggtcaatggtcagtaatatgacagaagaa
aaggccaatgcaattgcatgggctcttgcccagattccacaaaaggttctttggagattt
gacggcaaaactccagccaccttaggacccaataccagaatctacaagtggcttccccaa
aatgatcttcttggtcatccaaaaaccaaagcctttataactcatggtggcgcgaatgga
ctctacgaggcgatccatcatggaatccctatgattggcattcctttgtttggagaacaa
catgataacattgctcacatggtggccaaaggagcagctgttacattgaatatcagaacg
atgtcaaggtcagatttgctcaatgcactggaggaagtcatagacaatcctttctataaa
gagaatgctatgtggttgtcaaccattcaccatgaccagcctatgaagcccctggacaga
gcagtcttctggattgagtttgtcatgcgccacaaaggggccaagcatctgagaccactt
gcatacaacctcacctggtaccagtaccactctctggatgtgattggattcctgcttgct
tttgtgacattcattgtagccctcattgtaaagtgcttcttgtttgtttaccgattcttt
gtaaagaaagaaaagaaaatgaagaatgagtag

DBGET integrated database retrieval system