KEGG   Mus musculus (mouse): 231580Help
Entry
231580            CDS       T01002                                 

Gene name
Gak, D130045N16Rik
Definition
(RefSeq) cyclin G associated kinase (EC:2.7.11.1)
  KO
K08855  
cyclin G-associated kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     231580 (Gak)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  NAK family [OT]
   231580 (Gak)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 1305 aa AA seqDB search
MSLLQSALDFLAGPGSLGGAAGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDL
GSGREYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLTELCKGQLVEFLKRVECKGPLSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPVNDTRYTVFHDLIRAMLKVNP
EERLSIAEVVRQLQEIAAARNVNPKAPITELLEQNGGYGNSGPSRAQPPCGGTVNSSGVL
ALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVMSF
PAEGVESAIKNNIEDVRMFLDAKHPGHYAVYNLSPRIYRASKFHNRVTECGWAVRRAPHL
HSLYTLCRSMHAWLREDHRNVCVVHCMDGRAASAVAVCAFLCFCRLFSTAEAAVYMFSMK
RCPPGIWPSHKRYIEYVCDMVAEEPITPHSKPMLVKSVVMTPVPLFSKQRNGCRPFCEVY
VGEERVTTTSQEYDRMKEFKIEDGKAVIPLGVTVQGDVLIIIYHARATLGGRLQAKMASM
KMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAPPW
ENTSLRGLNPKILFSNREEQQDILSKFGKPELPRQPGSTAQYDAEAGSPEAEITESDSPQ
SSSTDTNHFLHTLDWQEEKEPETGLDNTSPKESQSVLIADGDGSEVSDEEEASFPSEERK
PGAGEDTPRLAAGTKQQDLIFDVGMLAAPQEPVQPEEGVDLLGLHSEGDLRPAAPLQACG
VPSSNTDLLSCLLEPSDAAQVGPPGDLLGGEAPLLLASPVSPLGLQNNLQGKVPDTVDPF
DQFLLSSNSDTQPCSKPDLFGEFLNSDSVASSTAFPSTHSAPPPSCSTAFLHLGDLPAEP
SKVIASSSHPDLLGGWDTWADTATPGPASIPVPEGTLFSSAGHPAPPGPNPSQTKSQNLD
PFADLSDLSSSLQGLPAGLPAGGFVGAPAPTQKSNSPWQANRPTAPGTSWTPQAKPAPRA
SEQLRSHFSVIGAREERGVRVPSFAQKPKVSENDFEDLLPNQGFSKSDKKGPKTMAEMRK
QELARDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVSMADLVTPEQVKKQ
YRRAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGSRPLF
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctgcagtctgcgctggacttcctggcgggccctggttctcttggcggagct
gcgggccgtgatcagagtgacttcgtggggcagacagtggagctgggcgagctgcgtctg
cgggtgcggcgggtcctggccgagggagggtttgcttttgtttatgaagctcaagatctg
ggaagtggcagagagtatgcattaaagcgattactatccaatgaagaggaaaagaacaga
gccatcattcaggaagtttgtttcttgaaaaaactttctggccaccccaatattgtccag
ttctgctctgcagcatccataggaaaagaggagtcggacactgggcaggctgagttcctc
ctgcttacggagctttgtaaaggacagctggtggagtttctcaagagagttgaatgtaaa
ggtcctctgtcctgcgacagcattctgaagatcttctaccagacatgcagagcagtgcag
cacatgcacaggcagaaaccacccatcatccacagagatctcaaggttgaaaacttactg
cttagtaaccaggggaccattaagctgtgtgactttggcagtgccacaaccatctcccat
tatcctgactacagctggagtgcccagaagcgagccatggtggaggaagagatcacaagg
aacaccacacccatgtacagaacaccagaaattgtagacctgtattccaacttccccatt
ggcgaaaagcaggatatctgggcactgggctgtatcttatacctgctgtgtttccggcag
catccttttgaggatggagcaaaacttcggatagtcaatgggaagtattccattcctgtg
aatgacactcgttacacagtcttccatgaccttattcgtgccatgctaaaggtcaaccca
gaggagaggctgtccattgctgaagtggtccgacaactgcaggaaattgcagcagctagg
aatgtgaaccccaaagctcccatcacagagctgctggagcagaatggtggctatgggaac
tcagggccttcccgagcacaaccaccttgcgggggcaccgtgaacagcagtggagttttg
gctctggcagagtatgaccagccctacggtgggtttcttgatattctgcggggtgggacc
gaacggctcttcaccaacctcaaggatacttcctccaaggtcatccagtctgtggctaac
tatgcaaagggtgatctggacatatcttacatcacatccaggattgcagtgatgtcattc
ccagcagaaggtgtggagtctgcaatcaaaaacaatatagaggatgtgcgaatgtttctg
gatgctaagcatccaggacattatgctgtctacaacctttctccaaggatataccgggct
tccaagtttcacaaccgggtcactgagtgtggctgggcagtcagacgggcaccacatctc
cacagtttgtatactctatgtaggagcatgcatgcctggctccgggaagaccacaggaac
gtctgtgttgtgcattgcatggatgggagagctgcatctgctgtggcagtctgtgcattc
ctgtgcttctgccgtctcttcagcactgcagaggctgctgtgtacatgttcagcatgaag
cgctgcccaccaggcatttggccatcccacaaaaggtacattgaatatgtatgtgacatg
gtggcagaggagcccatcacgccccatagcaagccaatgctggtgaaatctgttgtcatg
acccccgtgccactgttcagcaagcagaggaatggctgccgaccgttctgtgaggtctac
gttggagaggagcgtgtcaccaccacgtcgcaggaatatgacagaatgaaggaatttaaa
attgaggatggcaaggctgtcatccccctgggcgtaacagttcaaggagacgtgctcatc
atcatctaccatgccagggccacactgggagggaggctgcaggctaagatggcgtccatg
aaaatgttccagatccagttccacactgggttcgtgcctcgaaacgcaaccactgtgaaa
tttgcaaaatatgacctggatgcttgtgatattcaagagaagtacccagatctgttccag
gtgaacctggaagtggaggtagagcctagagacaggcccagccgagaagctccaccttgg
gagaacaccagcctaagggggttaaaccccaagatcctcttttccaacagggaagagcag
caggacattctgtctaagtttgggaagccggagctaccccggcagccgggctccacagct
cagtatgatgctgaggcagggtctccggaggctgagatcacagagtcggactcaccgcag
agcagcagtacggacaccaaccactttcttcacacactggattggcaggaggaaaaagaa
ccagagactgggttagacaatacctctcctaaggagagtcagtctgtcctgattgcagac
ggagatggaagtgaagtatcagatgaagaagaggcttcattccccagtgaggagaggaaa
ccaggagctggagaagatacaccaaggctggctgctgggaccaaacagcaagacttaata
tttgatgtgggcatgctggctgccccacaggagcctgtacagcccgaagaaggtgttgat
ctcctggggctacactctgagggggacttaaggcctgctgcccccttacaggcttgtggg
gtcccatctagcaacactgacctgttgagctgccttcttgaaccatctgatgctgctcaa
gtagggcctcctggtgacctgcttggtggtgaggctccactgctgctagcaagcccagtt
tctcctcttgggctgcagaacaacctacaaggaaaagtccctgacactgtggacccattt
gaccagttcctgctgtcatccaactcagacacccagccctgctccaagcctgatctcttt
ggagagtttctcaactctgactctgtagcttcctcaactgccttcccatccacccacagt
gccccacccccatcctgtagcactgccttcctgcacctaggggatctgccagcagagccc
agcaaggtaatagcttcatccagccacccagatctgctaggaggatgggatacgtgggct
gacacagctacacctgggccagcctccattccagtaccagaaggtaccctcttctcttct
gcaggtcacccagcccctcctggccccaaccccagccaaaccaagtctcagaaccttgac
ccatttgctgatctcagtgatctcagctctagcctccaaggcctgcctgctggacttcct
gcagggggctttgttggcgcaccagcccccactcaaaagagcaacagcccctggcaggca
aatcgtcccacagcccctggaacctcatggaccccccaggccaagccagcccccagagcc
tctgaacagctaaggtctcacttcagtgtgatcggggcccgagaagagaggggcgtccgt
gtgcccagctttgcccaaaagccaaaggtctcagaaaatgattttgaagatcttctgcct
aatcaaggcttctctaagtctgacaagaaggggccaaagaccatggcagagatgcggaaa
caggaacttgccagagatacagacccactcaaattgaagcttttggactggattgaaggc
aaggagaggaacattcgtgcactgctgtccactctgcacacggtattgtgggatggggag
agccgctggacacctgtgagtatggctgacctggtgactccagagcaggtgaagaagcag
taccgccgtgcagtgctggtagtgcatcctgataaggccacagggcagccgtatgaacag
tatgccaagatgatcttcatggagctgaatgatgcatggtctgagtttgaaaaccagggc
tcgaggcccctcttctga

DBGET integrated database retrieval system