KEGG   Mus musculus (mouse): 232232Help
Entry
232232            CDS       T01002                                 

Gene name
Hdac11
Definition
histone deacetylase 11 (EC:3.5.1.98)
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
Human Diseases; Substance dependence; Alcoholism [PATH:mmu05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 D1; 6
AA seq 347 aa AA seqDB search
MPHATQLYQHVPEKRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDGML
VEAREASEEDLLVVHTRRYLNELKWSFVVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMGDKRVYIMDVYNRHIYPGDRFAKEAIRRKVELEWGTEDEEYLEKVER
NVRRSLQEHLPDVVVYNAGTDVLEGDRLGGLSISPAGIVKRDEVVFRVVRAHDIPILMVT
SGGYQKRTARIIADSILNLHDLGLIGPEFPCVSAQNSGIPLLSCAVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgcaacacagctgtaccagcatgtaccagagaaacgctggcccatcgtgtac
tcaccacgttacaacatcaccttcatgggcctggagaagctgcacccctttgatgctggg
aaatggggcaaggtgatcaacttcctgaaagaagagaagctgctgtccgatggcatgctg
gtggaggctcgggaggcctcggaggaggacctgctggtggtgcacacgaggcgctatctc
aacgagctgaagtggtcctttgtggtggctaccatcactgagatccccccggtcatcttt
cttcccaacttccttgtgcagaggaaggtgctgaggcccctgcggacccagactggaggc
accatcatggcagggaagctggctgtggagcgaggctgggccatcaatgttggtggtggc
ttccaccactgctccagtgaccgtggtgggggcttctgtgcctatgcagacatcacactg
gctatcaagttcctgtttgaacgcgtggaaggcatctccagagccaccatcattgatctc
gatgcccaccagggcaatgggcatgagcgagacttcatgggtgacaagcgagtatacatc
atggatgtttacaaccgccacatctaccctggggatcgctttgctaaagaggccatcagg
cggaaggtggaattggagtggggcacagaagatgaggaatatctggagaaggtggagagg
aatgtcaggaggtccctccaggagcacctgcctgacgtggtggtgtacaacgctggcacg
gacgtgctggagggagaccgcctcggggggctgtccatcagcccagcgggcattgtgaag
agggatgaagtggttttccgcgtggtccgagcccatgatatacccatcctcatggtgacc
tcgggtgggtaccagaagcgcacagcccgtattatcgccgactccatcctcaacttgcat
gacctggggctcattgggcctgagtttccctgcgtctcggcacagaactcgggcatcccc
ctgctttcctgtgctgtgccttga

DBGET integrated database retrieval system