KEGG   Mus musculus (mouse): 232232Help
Entry
232232            CDS       T01002                                 

Gene name
Hdac11
Definition
histone deacetylase 11 (EC:3.5.1.98)
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    232232 (Hdac11)
  Substance dependence
   05034 Alcoholism
    232232 (Hdac11)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     232232 (Hdac11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 D1; 6
AA seq 347 aa AA seqDB search
MPHATQLYQHVPEKRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDGML
VEAREASEEDLLVVHTRRYLNELKWSFVVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMGDKRVYIMDVYNRHIYPGDRFAKEAIRRKVELEWGTEDEEYLEKVER
NVRRSLQEHLPDVVVYNAGTDVLEGDRLGGLSISPAGIVKRDEVVFRVVRAHDIPILMVT
SGGYQKRTARIIADSILNLHDLGLIGPEFPCVSAQNSGIPLLSCAVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgcaacacagctgtaccagcatgtaccagagaaacgctggcccatcgtgtac
tcaccacgttacaacatcaccttcatgggcctggagaagctgcacccctttgatgctggg
aaatggggcaaggtgatcaacttcctgaaagaagagaagctgctgtccgatggcatgctg
gtggaggctcgggaggcctcggaggaggacctgctggtggtgcacacgaggcgctatctc
aacgagctgaagtggtcctttgtggtggctaccatcactgagatccccccggtcatcttt
cttcccaacttccttgtgcagaggaaggtgctgaggcccctgcggacccagactggaggc
accatcatggcagggaagctggctgtggagcgaggctgggccatcaatgttggtggtggc
ttccaccactgctccagtgaccgtggtgggggcttctgtgcctatgcagacatcacactg
gctatcaagttcctgtttgaacgcgtggaaggcatctccagagccaccatcattgatctc
gatgcccaccagggcaatgggcatgagcgagacttcatgggtgacaagcgagtatacatc
atggatgtttacaaccgccacatctaccctggggatcgctttgctaaagaggccatcagg
cggaaggtggaattggagtggggcacagaagatgaggaatatctggagaaggtggagagg
aatgtcaggaggtccctccaggagcacctgcctgacgtggtggtgtacaacgctggcacg
gacgtgctggagggagaccgcctcggggggctgtccatcagcccagcgggcattgtgaag
agggatgaagtggttttccgcgtggtccgagcccatgatatacccatcctcatggtgacc
tcgggtgggtaccagaagcgcacagcccgtattatcgccgactccatcctcaacttgcat
gacctggggctcattgggcctgagtttccctgcgtctcggcacagaactcgggcatcccc
ctgctttcctgtgctgtgccttga

DBGET integrated database retrieval system