KEGG   Mus musculus (mouse): 232493Help
Entry
232493            CDS       T01002                                 

Gene name
Gys2, BC021322, LGS
Definition
glycogen synthase 2 (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    232493 (Gys2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    232493 (Gys2)
   04152 AMPK signaling pathway
    232493 (Gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    232493 (Gys2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     232493 (Gys2)
Glycosyltransferases [BR:mmu01003]
 Polysaccharide
  Storage polysaccharide
   232493 (Gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 G2; 6
AA seq 704 aa AA seqDB search
MLRGRSLSVTSLGGLPVWEAERLPVEDLLLFEVSWEVTNKVGGICTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPTNDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
SSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNQLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCLKEKFGKKLYDGLLRGEIPDMNSIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHLEPTSPPTTDGFKYPRPSSVPPSPSGSQASSPQCSDAE
DEEDEDERYDEEEEAERDRLNIKSPFSLNHFPKGKKKLHGEYKN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaggccgctccttgtcggtgacatcccttggtgggctccctgtgtgggaagct
gaaagactccctgtggaagacttactgctttttgaagtttcttgggaggtgaccaacaaa
gttgggggcatctgtactgtgatccagaccaaggccaaaacgacagccgatgagtgggga
gagaattacttcctgataggtccgtactttgagcataatatgaagactcaagtagaacaa
tgtgagcccaccaacgatgctgtcagaaaagctgtggatgcgatgaataaacatggctgc
caggtgcattttggaagatggctcatagaagggagtccctacgtggtgctctttgacatc
agctcctcagcatggaacctggacagatggaagggtgacttctgggaagcttgtggcgtt
ggcatccctcatcatgaccgagaagctaacgacatgctcatatttgggtctttaactgcc
tggttcttaaaggaggtgacagaccacgcagacggtaaacacgtcattgcccaattccat
gaatggcaggctgggactgggctgatcctttctcgtgccaggaaactccccattgccaca
gtatttacaacccatgccacactgcttgggcgttatctctgtgcagcaaatattgacttc
tacaaccagcttgacaagttcgacattgacaaagaggccggggagaggcagatataccac
cgctactgcatggagcgggcatccgtgcactgtgcgcacgtgttcaccacagtgtcagaa
atcacagccatcgaggcagagcacatgctgaagaggaagcctgatgtagtgactccaaat
ggtttgaatgttaagaagttttctgcagtgcatgaatttcaaaatctccacgccatgtac
aaggccaggatacaggatttcgttcgaggtcatttctatggtcatctggactttgatctt
gagaagactttattcctcttcattgctgggagatatgaattctcaaacaaaggagcagac
atcttcctggagtccttatccaggcttaatttcctcctgaggatgcataagagtaacgtc
accgtggtagtgtttttcatcatgcctgccaagacaaacaatttcaacgtggaaaccctg
aagggccaggcagtgcggaaacagctgtgggacactgtgcattgtttgaaggagaagttt
gggaagaaactctatgacgggttattaagaggagaaattcctgacatgaatagtattttg
gatcgagatgacttaacaattatgaaaagggccattttttcaactcagagacagtctttg
cctcctgtgaccactcacaatatgatcgatgattccacggatcccatcctcagcaccatt
agacgaatcggacttttcaacaatcgtgcagacagagtcaaggtgattttacacccagaa
ttcctgtcctccaccagccctctattgcccatggattatgaagagtttgtccgaggttgt
caccttggggtgtttccatcgtactatgaaccctggggttacacaccagctgaatgcaca
gtgatgggcatccccagtgtgactacaaacctctccggttttgggtgtttcgtgcaggag
catgtggctgaccctactgcatacggtatttacatcgtggacagacgcttccgctctcca
gacgattcttgcaaccagctgactcagttcctctacgggttttgtaaacagtcacgccgg
caaaggatcattcagaggaaccgcacggagaggctctcagatctcctggactggagatac
ctgggcagatattaccagcatgccagacacctgacactgagcagggcttttccagacaaa
ttccacctagagcccacatcaccaccaacgacggatggctttaagtatcccaggccctcc
tcagtaccaccttctccgtcaggatcccaggcctccagtcctcagtgcagtgatgcggaa
gacgaagaagatgaggatgagaggtatgatgaggaagaggaggctgagagggatcggcta
aatatcaagtcaccgttttctctgaaccactttccaaaggggaagaaaaagcttcatgga
gaatataagaactga

DBGET integrated database retrieval system