KEGG   Mus musculus (mouse): 232533Help
Entry
232533            CDS       T01002                                 

Gene name
Stk38l, 4930473A22Rik, B230328I19, Ndr2, Ndr54
Definition
(RefSeq) serine/threonine kinase 38 like (EC:2.7.11.1)
  KO
K08790  
serine/threonine kinase 38 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     232533 (Stk38l)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  NDR family
   232533 (Stk38l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 G3
AA seq 464 aa AA seqDB search
MAMTAGATTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLAD
EEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKI
LRKADMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLM
KKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDNLLLDAKGHVKLSDFGLCTGLKK
AHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGY
NKLCDWWSLGVIMYEMLIGFPPFCSETPQETYRKVMSWKETLAFPPEVPVSEKAKDLILR
FCTDSENRIGNGGVEEIKGHPFFEGVDWGHIRERPAAIPIEIRSIDDTSNFDDFPESDIL
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacggcaggggcaacaactacctttcctatgagcaaccatacccgggaaaga
gtaactgtggccaagctcacactggagaatttttacagcaacctaattttacagcatgaa
gagagagaaaccaggcagaagaagttagaagtggctatggaagaagaaggattggcagat
gaggagaaaaagttacgtcgatcgcagcatgctcgtaaagaaacagagttcttacgcctt
aagaggaccagacttggcctagatgactttgagtctctgaaggttataggaagaggagct
ttcggagaggtgcggctggtccagaagaaagacacggggcacatctatgccatgaagatc
ctgaggaaagctgacatgcttgagaaagagcaggtggctcatatccgagcagaaagggac
attttggtggaagcagatggagcctgggtggtgaagatgttctacagttttcaggacaaa
cggaatctctatctcatcatggaatttcttcctggaggtgacatgatgacattgctgatg
aagaaggacaccttaacagaagaagagacacagttctacatctcagagactgtcttggcg
atagatgcaattcaccagctgggcttcatccaccgggacgtcaaaccagacaacctttta
ctggatgccaagggacatgtaaaattatctgattttggtttgtgcacggggttaaagaaa
gctcacaggactgaattctacagaaacctcacacataacccgccaagcgacttctcattt
cagaacatgaattcaaagcggaaagcagagacatggaagaagaacaggagacagctggct
tactccacagttggaacaccagactacattgctccagaagtattcatgcagactggctac
aacaaattgtgtgactggtggtccttgggagtgattatgtacgagatgctaataggcttt
ccacctttctgctctgaaacaccacaagaaacatacagaaaagttatgagctggaaggag
actctggcatttcctccggaagtgcccgtctctgagaaagccaaggacttgattctcaga
ttttgtactgattctgaaaacagaattgggaatggtggtgtggaagaaatcaaaggtcat
ccgttctttgagggtgtagactgggggcacataagggaaagaccagcagctattcctata
gaaatccggagtatagatgacacctcaaactttgatgacttccctgagtctgatatctta
cagccagtgccgaataccacagagcccgactacaaatccaaagactgggtttttctcaat
tacacctacaaaaggtttgaagggctgacccagagaggctccattcctacatacatgaaa
gctgggaagttatga

DBGET integrated database retrieval system