KEGG   Mus musculus (mouse): 232714Help
Entry
232714            CDS       T01002                                 

Gene name
Mgam, 6030407P20Rik, MGA
Definition
maltase-glucoamylase (EC:3.2.1.20 3.2.1.3)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmu00500]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:mmu04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6 B1; 6
AA seq 1827 aa AA seqDB search
MAGRRFKKFSKLELVLIVLLLVLFIIAVVLIVLLANSTPENAIGAETTGTPDTTVTRTTL
NSPNCPVLSELERINCIPDQSSNKGTCDERGCCWDPQGSISVPCYYSRNHGYKMESDVVN
TNAGFTATLKNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFS
GNAPSSLNYKVEVSKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGL
GEHVHQQYRHNMNWKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNA
MEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYD
YKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNNGQK
LVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNC
AVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNNLNYPPFTPKVLDGYLFSK
TLCMDAVQHWGKQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWL
GDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNH
NGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFY
DDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQSIEMQL
PGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVA
QNIYLFSEFSVTQNHLDVTISSPNYKDPNNLEFQEIKIFGTREFRNVRVKQNGNLLQMSP
QVTYNPNLKVATITNIHLRLGEAYTVEWDFFTREEERIDCYPDEHGASEANCSARGCIWE
ASNTTRGPPCYFAHELYSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHK
NEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLIKENPFGIQIRRKTTGTVIW
DSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMNWHTWGMFSRDEPPGYKKNS
YGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVT
QQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQ
LDFKLSPKFSGFPALINRMKANGMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNN
GSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQ
DPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMES
EQILPDGSRVRHYDVHNLYGWSQTRPTYEAVQEVTGERGIVITRSTFPSSGRWGGHWLGD
NTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNT
IGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRE
TWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKGVDINATGEWKTLEAPLEY
INLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINTDQYYLA
RFSVNQTTLLTHEKFNNYLTGTAPLYLGYIDIWGLSSSSITNVSISWNTNNEEVFANYNS
TTKILSVNMTDKKISLHTFNSLTWSSS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacggaggtttaagaagttcagcaagctggagcttgttctcattgttctgctg
cttgtcctgttcatcatcgcggtggttctaattgtgctcttagccaactcgactccagaa
aatgccataggtgctgaaacaactggcactccagacactacagtcaccaggaccactctt
aactctcccaattgcccagtgctaagtgagctggaacggataaattgcatccctgaccag
tcatctaacaagggcacatgtgatgagcgaggctgctgctgggatcctcagggatccatc
agtgttccttgctattactccaggaatcatggctacaaaatggagagtgacgttgtaaac
acaaatgcaggattcacagccacactgaaaaacttaccttctgcacccgtgtttggaaac
agcatcgaaaacatcctgcttacagcagagtaccagacatcaaatcgcttccactttaag
ttgactgaccaaaccaagaagaggtacgaagtgccccacgagcacgtgcaacccttcagt
ggaaatgccccttcttccttgaactacaaagttgaggtttccaaggagccatttagcatc
aaagtcaccagaaaaagcaataaccgtgtgctgtttgactcaagtattgggcccctcctc
ttctctgaccagttcctgcagttctctacccacctgccaagtgctaatgtatatggtctg
ggtgaacatgtgcaccagcagtaccgacacaatatgaattggaagacctggcccatgttt
tccagagacacaaccccgaatgaggatggaactaacttgtatggtgtgcagacgttcttc
ctgtgccttgaagataacagtggattgtccttcggggtgtttctgatgaacagcaatgcc
atggaggttactcttcagcctaccccagcaatcacataccgcaccactgggggaattctg
gacttctatgtgttcttggggaacacacctgagcaagttgttcaagaatatctagagctc
attggacggccagctctgccttcatactggacacttgggtttcagctcagccggtatgat
tataaaagcctagataatatgaaagcagttgtggagagaaaccgtgcagcacaactccct
tatgatgttcagcatgctgatattgattatatggatcagaagaaggacttcacttatgac
ccagtgaattttaaaggcttcccagagtttgttaaggagctacacaataatgggcagaaa
cttgttatcattttggatccagcaatttccaacaactctttctcaagtaatccttatggc
ccatatgacaggggttcagcaatgaaaatctgggtgaatagttctgatggcatcagtcca
gtcattggaaaggtctggcctggaacaactgtgtttcctgattacaccagtcccaactgt
gctgtttggtggacaaaagaatttgagcttttccacaaagaagtggagtttgatggaatt
tggattgatatgaacgaagtctccaactttattgatggttcattttctggatgttcccaa
aacaacttgaattatcccccattcacaccaaaagtcctggatgggtacttgttctctaag
actctctgcatggatgccgttcagcactgggggaagcagtatgatgtccacaatctatat
ggctactccatggccattgccacagcaaaagccgtgaaggacgtgttcccagacaagaga
agcttcatcataacccgctctacctttgctggttctggcaaatttgcagcccactggtta
ggagataacaccgccacctggaaggaccttcagtggtccatcccaggcatgcttgagttc
aacctcttcggtatcccaatggtaggggccgatatatgtggctttgcccaagacacatac
gaggagctctgcaggcgctggatgcagctgggggcattttatccattttctcggaatcac
aatggccaaggttacaaggaccaggatcctgcctcttttgggaataactccctgctgttg
aattcgtctaggcactaccttaacatccgctacactttgctgccttacctctacactctt
ttctacagagcacacagccggggagacactgtagctaggcctcttctgcatgagttctat
gacgacaacaatacttggggcatagaccggcaatttctttggggaccaggtcttctcatc
actcctgttctggatcagggtgcagagaaagtgaaagcatatgtgcctaatgccacctgg
tacgactatgaaaccggagaggaactggggtggagaaagcaaagcattgagatgcaactt
cctggagacaagattggacttcaccttcgagggggctacatctttcccacacaacagcct
gccacaaccacagaagccagccggaagaatcctcttggtcttattgtcgccctggatgag
aacaaagaagcaagaggagagctgttctgggatgatggggagtcgaaggatactgtggcc
caaaacatttaccttttcagtgaattttctgtcactcaaaaccatttggatgtgacaatt
tcaagtccaaactacaaggatcccaataacctagaattccaggaaattaaaatctttgga
acacgggaattccgcaatgttagagtgaaacagaatgggaatctccttcaaatgtctcct
caagtcacttacaatccaaacctgaaggttgccaccatcacaaatatccatctcaggctg
ggagaagcgtacacggttgagtgggacttcttcacaagggaggaggaaaggatagattgc
tatccagatgagcatggtgcttctgaggcaaactgcagtgcccgtggctgcatctgggag
gcatccaacactactaggggccctccttgctactttgctcatgagctgtactcagtcagc
aatgttcagtacgactcacatggggccacagctgacatctccttgaaggcttctacttat
agcaatgccttcccctctacacctgtgaataaactgaaactgcaagtgacctatcacaag
aacgaaatgctgcagtttaagatctatgatcccaaccacagtcggtatgaagtcccagtc
cctctgaacatccccagtgctccattgagcacccctgaaggccgtctgtatgatgtcctc
atcaaggagaatccatttgggattcaaattcgccggaagactacaggcactgtaatctgg
gactctcagctcctcggcttcaccttcaatgacatgttcatccgcatctccacccgcctg
ccctccacatacatctatggctttggggaaactgagcacacaaccttcaagatagacatg
aactggcacacatggggcatgttttccagggatgagcccccggggtacaagaagaattct
tatggtgttcacccttactacatggggctggaggaagatggcaatgcccatggagtcctc
ctgatgaacagcaatgccatggatgtgaccttccagcccatgcctgccctgacataccga
accatagggggcattctggacttctatgtgttcttgggcccaactccagagattgttact
caacaatatacagagttgattggtcggcctgtgatggtaccttattggtctctgggattc
cagctgtgtcgctatggatatgagaatgatactgaaattgccaacctgtatgatgaaatg
gtggctaagcagattccctatgatgtgcagtactcagacattgactacatggagaggcag
ctggacttcaagctcagccccaagttctctgggtttccagccctgatcaatcgcatgaag
gccaatgggatgagggtcatcctcattctggatccagccatttctggcaacgagacagag
ccctacccggccttcacccggggtgtggagaatgacgtcttcatcagatatcccaataat
ggaagcattgtctggggaaaggtctggcctgattaccctaatatcactgtggacccttct
ttaggctgggaccatcaagtggagcaataccgagcttatgtggccttcccagactttttc
cgtaattcaactgctacatggtggaagaaggagattaaagaactccacagcaacacacag
gatcctgccaagagcttgaagtttgatggcctgtggattgatatgaatgaaccttccagc
tttgtgaatggggcagttccttctggctgcagcgatgctactctgaaccaccctccctac
atgccatatttggaagccagggacaggggcctgagcagtaagaccctgtgcatggagagt
gagcagatccttccagatggctcccgggtacggcactatgatgtacacaacctgtatggg
tggtcccagaccagacctacctacgaagctgtgcaggaggtgacaggagagagagggatc
gtcatcacacgctccacattcccctcttctggacgctggggaggacactggctgggagac
aacacagctgcctgggaccagctggggaaatccatcattggcatgatggatttcagcctc
ttcggcatatcctataccgggtcagacatctgtgggttctttcaagatgctgagtatgag
atgtgtgttcgctggatgcagctgggcgccttttaccccttctccaggaaccacaacacc
atcgggacccggagacaagaccctgtatcctggaataaaacctttgaggatatttccaga
agtgtgttggaaaccagatacaccctgttgccatatctctacaccttgatgtacaaggcc
cacacggagggcagcacagttgtgaggcctcttctccatgagtttgtgtcagaccgggag
acctggaatatagacaaacagttcctgttgggcccagccttcctagtcagccctgtgctt
gagcctaatgccagaaaggttgaagcatattttcccagggcccgctggtatgactactac
aagggtgtagatatcaatgcaacgggagagtggaagaccttggaagcccctcttgagtac
attaatcttcatattcgtgggggttatattctgccctggcaggaacctgccatgaacacc
catttaagccggcagaagttcatgggcctcagggctgcgttgaatgctgagggacgtgct
gagggctggctcttctgggatgatgggaaaaggatcaataccgatcagtactacttggcc
aggttttctgtcaaccagactacattgctgacgcatgaaaagtttaacaattacctcact
ggcacagcacccttatatctaggctacattgatatctggggattgagcagttcttccatt
accaatgtgagcatctcttggaacactaataatgaagaagtctttgccaactacaactcc
acaaccaagatactgagtgtcaatatgactgacaaaaaaatcagcctgcacactttcaat
tcactgacatggagctcttcataa

DBGET integrated database retrieval system