KEGG   Mus musculus (mouse): 233571Help
Entry
233571            CDS       T01002                                 

Gene name
P2ry6, 2010204J23Rik, P2Y6
Definition
(RefSeq) pyrimidinergic receptor P2Y, G-protein coupled, 6
  KO
K04272  
purinergic receptor P2Y, G protein-coupled, 6
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    233571 (P2ry6)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    233571 (P2ry6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 E3
AA seq 328 aa AA seqDB search
MEQDNGTIQAPGLPPTTCVYREDFKRLLLTPVYSVVLVVGLPLNICVIAQICASRRTLTR
SAVYTLNLALADLMYACSLPLLIYNYARGDHWPFGDLACRFVRFLFYANLHGSILFLTCI
SFQRYLGICHPLASWHKRGGRRAAWVVCGVVWLAVTAQCLPTAVFAATGIQRNRTVCYDL
SPPILSTRYLPYGMALTVIGFLLPFIALLACYCRMARRLCRQDGPAGPVAQERRSKAARM
AVVVAAVFAISFLPFHITKTAYLAVRSTPGVSCPVLETFAAAYKGTRPFASVNSVLDPIL
FYFTQQKFRRQPHDLLQRLTAKWQRQRV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggacaatggcaccatccaggctccaggcttgccgcccaccacctgcgtctac
cgtgaggatttcaagcgactgctgctaaccccggtatactcggtggtgctggtggtcggc
ctgccactgaacatctgcgtcattgcccagatctgcgcatcccgccggaccctgacccgt
tccgctgtgtacaccctgaacctggcactggcggacctgatgtatgcctgttcactaccc
ctacttatctataactacgccagaggggaccactggcccttcggagacctcgcctgccgc
tttgtacgcttcctcttctatgccaatctacatggcagcatcctgttcctcacctgcatt
agcttccagcgctacctgggcatctgccaccccctggcttcctggcacaagcgtggaggt
cgccgtgctgcttgggtagtgtgtggagtcgtgtggctggctgtgacagcccagtgcctg
cccacggcagtctttgctgccacaggcatccagcgcaaccgcactgtgtgctacgacctg
agcccacccatcctgtctactcgctacctgccctatggtatggccctcacggtcatcggc
ttcttgctgcccttcatagccttactggcttgttattgtcgcatggcccgccgcctgtgt
cgccaggatggcccagcaggtcctgtggcccaagagcggcgcagcaaggcggctcgtatg
gctgtggtggtggcagctgtctttgccatcagcttcctgcctttccacatcaccaagaca
gcctacttggctgtgcgctccacgcccggtgtctcttgccctgtgctggagaccttcgct
gctgcctacaaaggcactcggcccttcgccagtgtcaacagtgttctggaccccattctc
ttctacttcacacaacagaagttccggcggcaaccccacgatctcttacagaggctcaca
gccaagtggcagaggcagagagtctga

DBGET integrated database retrieval system