KEGG   Mus musculus (mouse): 233649Help
Entry
233649            CDS       T01002                                 

Gene name
Cnga4
Definition
(RefSeq) cyclic nucleotide gated channel alpha 4
  KO
K04951  
cyclic nucleotide gated channel alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    233649 (Cnga4)
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    233649 (Cnga4)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   233649 (Cnga4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7; 7 E3
AA seq 575 aa AA seqDB search
MSQDSKVKTTESTPPAPTKARKWLPVLDPSGDYYYWWLNTMVFPIMYNLIIVVCRACFPD
LQHSYLVAWFVLDYTSDLLYLLDIGVRFHTGFLEQGILVVDKSMIASRYVRTWSFLLDLA
SLVPTDAAYVQLGPHIPTLRLNRFLRVPRLFEAFDRTETRTAYPNAFRIAKLMIYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPLPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRRLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQAVMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLKGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPDDMGEADDEAEPGEGTSKDGEEKAGQEGPSGLE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggacagcaaagtgaagacaacagagtccacgcccccagccccaaccaaagcc
aggaagtggctgccagtcctagacccatctggggattattactactggtggctgaacacg
atggtcttcccaatcatgtataatctcatcatcgttgtatgcagggcctgctttcctgac
ttgcaacacagttacctggtggcctggtttgtgctggactacacgagtgacctgctgtac
ctactagatattggggtacgcttccacacaggattcctagaacagggcatcctggtggta
gacaaaagcatgatcgccagtcgctatgtacgcacctggagcttcctgttggacctggct
tccctggtccccacagatgcagcctacgtgcagctaggcccccacatccctacactccgg
ctaaaccgctttctccgagtgcctcgcctctttgaggctttcgaccgtacagagacccgc
acagcttacccaaatgccttccgcatagccaagctgatgatctacatttttgtcgtcatc
cattggaacagctgcttatacttcgccctgtccaggtacctgggcttcggacgggatgca
tgggtatacccagaccctgcgcagcctggctttgagcgcttgcggcgccagtatctctac
agcttctacttctccactctgatcctgaccactgtgggtgacacaccgctgccagcccga
gaggaagagtacctcttcatggtgggtgacttcctgctggccgtcatgggtttcgccacc
atcatgggtagcatgagctctgtcatttacaacatgaacacggcagatgcagccttctac
ccagaccatgctctggtaaagaaatacatgaagctacagcacgtcaaccgaaggctggag
cggcgcgttattgactggtaccagcatctgcagatcaacaagaagatgaccaatgaggta
gccatcttgcagcacttgcctgagcggctgcgggcagaggtcgctgtatccgtacacctg
tctaccctgagccgagtacagatcttccagaactgtgaagccagcctgctggaagagctg
gtgctaaagctccagccccagacctactcaccaggcgaatacgtatgccgcaaaggggac
attggccgagagatgtacatcatccgcgagggccagctggctgtggtggcagatgacggt
gtcacacagtatgctgtgcttggtgcagggctctactttggggagattagcatcatcaac
atcaaagggaacatgtctggaaaccgacgaacagctaacatcaagagcctgggctattca
gacctcttctgcctcagcaaggaggatctacgggaggtgctgagtgagtacccacaggcc
caggcagtcatggaggagaagggccgtgaaatcttgctcaaaatgaataaattggatgtg
aatgctgaggcagctgagatcgccctccaggaggccacagagtctcggctgaaaggcctc
gaccagcagcttgatgacctacagaccaagtttgctcgcctcctggctgagctggagtcc
agcgcactgaagatagcttaccgcattgaaaggctggagtggcagactcgagagtggccg
atgccagacgacatgggtgaggctgatgatgaggctgagcctggagaaggaacgtccaag
gatggagaggaaaaagctggccaggagggaccctcaggcctagaatga

DBGET integrated database retrieval system