KEGG   Mus musculus (mouse): 233765Help
Entry
233765            CDS       T01002                                 

Gene name
Plekha7, A430081P20Rik, AI414265
Definition
(RefSeq) pleckstrin homology domain containing, family A member 7
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F1
AA seq 1056 aa AA seqDB search
MSLRSTWATVCHNQQTTTFRHPVTGQFSSENSEYVLREEPHPHMSKPERNQRPSSMVSET
STAGTTSTLEAKPGPKIVKSSSKVHSFGKRDQAIRRNLNVPVVVRGWLHKQDSSGMRLWK
RRWFVLADYCLFYYKDSREEAVLGSIPLPSYVISPVAPEDRISRKYSFKAVHTGMRALIY
STTTAGSQMEHSGMRTYYFSADTLEDMNAWVRAMNQAAQVLSRSSLRRDVDKVERQAMPQ
ANHTDACQECGHVGPGHSRDCPRRGYEDSYGFNRREQEEERFRAQRDPLEGRRDRSKARS
PYLPAEEDALFVDLPGGPRGQQAQPQRAEKNGVPPYGLGEQNGTNGYQRTAPPRANPEKH
SQRKTGLAQAEHWTKAQKGDGRSLPLDQTLPRQGPSQPLSFPENYQSLPKSTRHLSGSSS
PPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAPIGAGS
PEFTEQGRSRSLLEVPRSISVPPSPSDIPPPGPPRPFPPRRPHTPAERVTVKPPEQRRSV
DISLGGSPRKARGHAAKNSSHVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQLKKDLEY
LDLKMTGRDLLKDRSLKPMKIAESDIDVKLSIFCEQDRILQDLEDKIRALKENKDQLESV
LEVLHRQTEQYRDQPQHLEKITCQQRLLQEDLVHIRAELCRESTEMENAWNEYLKLEKDV
EQLKQTLQEQHRRAFFFQEKSQIQKDLWRIEDVMAGLSANKENYRVLVGSVKNPERKTVP
LFPHPSVPSLSPTESKPALQPSPPTSPVRTPLEVRLFPQLQTYVPYRPHPPQLRKVMSPL
QSPTKAKPQAEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKRQSDERKR
DREQGQCVNGDLKVELRSYVSEPELASLSGDVPQPSLSLVGSESRYQTLPGRGLSGSTSR
LQQSSTIAPYVTLRRGLNAENSSATFSRPKSALERLYSGDHQRGKMSAEEQLERMKRHQK
ALVRERKRTLSQGEKTGLLSARYLSQPLPGDLGSVC
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaggtcaacctgggctacagtgtgccacaatcagcagacaacaacattcagg
catcctgtgactggacagttttcttcagaaaacagtgaatacgttctgcgggaggagcca
cacccacatatgtcgaagccagagagaaaccaaagaccgtccagcatggtcagtgagaca
tccacagctgggaccacgtccaccctggaggccaagcctggacccaagattgtcaagtcc
agcagtaaagtgcacagcttcgggaagagggaccaggccattcggaggaaccttaatgtt
ccggtggtggtgaggggctggctacacaagcaggacagctccgggatgaggctgtggaaa
agacgctggtttgtgctggctgattactgcttgttttattataaagacagccgagaggaa
gctgttctcgggagcatccctctgcccagctatgtcatctccccagtggccccagaggat
cgaataagccgcaagtattcctttaaggctgtgcatacggggatgagggcactcatctac
agcaccaccacagcgggctctcagatggagcactcgggcatgaggacctactacttcagt
gccgacaccctggaggacatgaacgcctgggtcagggccatgaaccaggctgcgcaggtg
ctgtctcgctcatcgctgaggagggacgtggacaaggtggagcggcaggccatgccacag
gccaaccacactgacgcctgccaagaatgtggccacgtgggacctgggcactcgagagac
tgtcctcgtcgaggctatgaggactcctatggcttcaacaggagggagcaggaggaggaa
cgcttccgtgctcaaagagacccactggagggcaggagggacaggagcaaggccaggtcc
ccatacttgccagctgaggaggatgccttgtttgtcgatctacctggtgggccccgaggc
cagcaagcacagccacagcgagccgagaagaacggggtgccaccttatggcctgggagaa
cagaatgggaccaatgggtaccagcggactgctcctcccagggccaacccagaaaaacac
agccagaggaagaccggcctggcccaggcagagcactggacaaaagctcagaagggggac
ggcaggagcttgcccttagaccaaacacttcctcgccagggtcccagccagcccctgtcc
ttcccggaaaactaccagagtcttcccaagagcactagacatctttctgggagctcgtca
ccccctccccggaacctgcccagcgactacaagtacgcacaggaccgagccagccacctg
aagatgtccagtgaagagcgccgggcacacagagacggcactgtgtggcagctctatgag
tggcagcagaggcagcagttccgtcacggcagccccaccgcacccataggagctggctcc
ccagagttcaccgagcagggtcgcagccggagcctgctggaggtgccccgctccatctcc
gtgcctccgtctccttctgacatccctcctcctgggcctccaaggccctttccgccccgg
cggccacatacaccagcagaaagggtcacagtgaagccacccgagcagaggaggagtgtg
gacatctctctggggggttctcccaggaaggcacggggtcatgctgccaagaactcctct
cacgtggaccggcgttccatgccctccatgggctacatgacccatacagtgagcgctccc
agcttacatggaaaatcggctgatgacacctacctccagctgaagaaggacctggagtat
ctggatctgaagatgacaggccgagaccttcttaaagatcgaagtctgaagcccatgaag
atcgccgagagtgacattgatgtcaagctgagcatcttctgtgagcaagacaggatactc
caggacttggaagacaagatccgagctctcaaggagaataaagatcagctagaatccgtg
ctggaggtgctgcacaggcagacagaacagtaccgagaccagccacagcacctggagaag
atcacttgccagcagaggctcctgcaggaggacctcgtccacatccgtgcggagctctgc
agagagtccacggagatggaaaatgcatggaacgagtacctgaagctggagaaggatgtg
gagcagctaaagcagaccctgcaggagcaacacaggagagccttttttttccaggagaag
tctcagatacagaaggatctgtggaggatcgaagatgtcatggcaggcctgagtgcgaat
aaagagaactacagagtcctggtgggatctgtcaaaaatccagaaagaaaaacggtgcct
ttgttccctcacccatctgtgccttcactctctccaactgagagcaagccggccctgcag
cccagccctcccaccagccccgtgcggacgcctctggaggtccgactctttccgcagctg
cagacctatgtgccataccgacctcacccgccccagctgaggaaagtgatgtctcctctg
cagtcaccaaccaaggcaaagcctcaggcggaagacgaggcacctcccaggccaccactt
cctgaactctacagcccagaggaccagcccccagctgtgccaccactgccgagagaagcc
accatcattcggcacacatctgtgcgtggactcaaacgacagtcggatgagaggaagagg
gaccgggagcagggccagtgtgtgaatggggacttgaaggtggagctccggtcctacgtg
agtgagccagagctggccagcctcagtggggacgtgcctcagccctccttgagcctcgtg
ggctctgagagcaggtaccagacgctgccaggcagagggctctcaggctccacgtccagg
ctccagcagtcgtccaccattgctccctatgtcacactccggagggggctgaatgccgaa
aacagcagtgcgaccttctctagacccaagagtgccttggagcgtctgtactcgggggac
caccagcggggcaagatgagtgcggaggaacagctggagcggatgaagcggcaccagaag
gctctggtccgagagcgcaagaggaccctgagccaaggagaaaagacgggtctgctctca
gcccgatacctcagccagccactgccaggagatctcggctcagtatgttag

DBGET integrated database retrieval system