KEGG   Mus musculus (mouse): 233789Help
Entry
233789            CDS       T01002                                 

Gene name
Smg1, 2610207I05Rik, 5430435M13Rik, C130002K18Rik, mKIAA0421
Definition
(RefSeq) SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans) (EC:2.7.11.1)
  KO
K08873  
serine/threonine-protein kinase SMG1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    233789 (Smg1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     233789 (Smg1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   233789 (Smg1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     233789 (Smg1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     233789 (Smg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F2
AA seq 3658 aa AA seqDB search
MSRRAPGSRLSSGGGGTKYPRSWNDWQPRTDSASADPDTLKYSSSRDRGVSSSYGLQPSN
SAVVSRQRHDDTRGHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRINNVTSPEFTSVQ
HGSRALATKDMRKSQERSMSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPENK
LVLVKQLDNILAAVHDVLNESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKFSS
SAKDEVKLLYLCATYRALETVGEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCILL
VARCYPHIFSTNFRDTVDILVGWHIDHTQKPSLTQQVSGWLQSLEPFWVADLAFSTTLLG
QFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLRVFSTVVRSIGERFSPIRGP
PITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVITYG
LDQLENCQTCGTDYIISVLNLLTLIVEQINTKLPSSFVEKLFIPSSKLLFLRYHKEKEVV
AVAHAVYQAVLSLKNIPVLETAYKLILGEMTCALNNLLHSLQLPDACSEIKHEAFQNHVF
NIDNANFVVIFDLSALTTIGNAKNSLIGMWALSPTVFALLSKNLMIVHSDLAVHFPAIQY
AVLYTLYSHCTRHDHFISSSLSSSSPSLFDGAVISTVTTATKKHFSIILNLLGILLKKDN
LNQDTRKLLMTWALEVAVLMKKSETYAPLFSLPSFHKFSKGLLANTLVEDVNICLQACSS
LHALSSSLPDDLLQRCVDVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQEIS
LALRSHMSKAPSNTFHPQDFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQSTIP
RNLLKTDAVLWQWAIWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQDVS
QWTTADNDEGHGSNQLRLVLLLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNRQT
CQDWLTRIRLSIMRVGLLAGQPAVTVRHGFDLLTEMKTNSLTQGSELEVTIMMVVEALCE
LHCPEAIQGIAVWSSSAVGKNLLWINSVAQQAEGRFEKASVEYQEHLCAMTGVDCCISSF
DKSVLTLANAGRNSASPKHSLNGESRKTVLSKSIDSSPEVISYLGNKACECYISIADWAA
VQEWQNAVHDLKKNSSSTSLNLKADFNYIKSLSSFESGEFVECTEQLELLPGENINLLAG
GSKEKIDMKKLLPNMLSPDPRELQKSIEVQLLRSSVFLATALNHMEQDQKWQSLTENVVK
YLKQTSRIAIGPLRLSTLTVSQSLPVLSTLQLYCSSALENTVSNRLSTEDCLIPLFSDAL
RSCKQHDVRPWMQALRYTMYQNQLLEKIKEQTVPIRSHLMELGLTAAKFARKRGNVSLAT
RLLAQCSEVQLGKTTTAQDLVQHFKKLSTQGQVDEKWGPELDIEKTKLLYTAGQSTHAME
MLSSCAISFCKSAKAEYAVAKSILTLAKWVQAEWKEISGQLRQVYRAQQQQNLSGLSTLS
RNILALIELPSANTVGEEHPRIESESTVHIGVGEPDFILGQLYHLSSVQAPEVAKSWAAL
ASWAYRWGRKVVDNASQGEGVRLLPREKSEVQNLLPDTITEEEKERIYGILGQAVCRPAG
IQDEDITLQITESEDNEDDDMVDVIWRQLISSCPWLSELDENATEGVIKVWRKVVDRIFS
LYKLSCSAYFTFLKLNAGQVLLDEDDPRLHLSHRAEQSTDDVIVMATLRLLRLLVKHAGE
LRQYLEHGLETTPTAPWRGIIPQLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIV
GTISLSSESQASGNKYSSAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKSGLNED
QAMMQDCYSKIVDKLSSANPTMVLQVQMLVAELRRVTVLWDELWLGVLLQQHMYVLRRIQ
QLEDEVKRVQNNNTLRKEEKIAIMREKHTALMKPIVFALEHVRSITAAPAETPHEKWFQD
NYGDAIDNALEKLKTPSNPAKPGSSWIPFKEIMLSLQQRAQKRASYILRLDEISPWLAAM
TNTEIALPGEVSARDTVTIHSVGGTITILPTKTKPKKLLFLGSDGKSYPYLFKGLEDLHL
DERIMQFLSIVNTMFATINRQETPRFHARHYSVTPLGTRSGLIQWVDGATPLFGLYKRWQ
QREAALQAQKAQDSYQTPQNPSIVPRPSELYYSKIGPALKTVGLSLDVSRRDWPLHVMKA
VLEELMEATPPNLLAKELWSSCTTPDEWWRVTQSYARSTAVMSMVGYIIGLGDRHLDNVL
IDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTQNIETALGVTGVEGVFRLSCEQVLHI
MRRGRETLLTLLEAFVYDPLVDWTAGGEAGFAGAVYGGGGQQAESKQSKREMEREITRSL
FSSRVAEIKVNWFKNRDEMLVVLPKLDSSLDEYLSLQEQLTDVEKLQGKLLEEIEFLEGA
EGVDHPSHTLQHRYSEHTQLQTQQRAVQEAIQVKLNEFEQWITHYQAAFNNLEATQLASL
LQEISTQMDLGPPSYVPATAFLQNAGQAHLISQCEQLEGEVGALLQQRRSVLRGCLEQLH
HYATVALQYPKAIFQKHRIEQWKAWMEELICNTTVERCQELYRKYEMQYAPQPPPTVCQF
ITATEMTLQRYAADINSRLIRQVERLKQEAVTVPVCEDQLKEIERCIKVFLHENGEEGSL
SLASVIISALCTLTRRNLMMEGAASSAGEQLVDLTSRDGAWFLEELCSMSGNVTCLVQLL
KQCHLVPQDLDIPNPVEASEAVHLANGVYTSLQELNSNFRQIIFPEALRCLMKGECTLES
MLHELDSLIEQTTDGVPLQTLVESLQAYLRNTAMGLEEETHAHYIDVARMLHAQYGELIQ
PRNGSVDETPKMSAGQMLLVAFDGMFAQVETAFGLLVEKLNKMEIPVAWRKIDIIREARS
TQVNFFDDDNHRQVLEEIFFLKRLQTIKEFFRLCGTFSKTLSGSSSLEDQNTVNGPVQIV
NVKTLFRNSCFSEDQMAKPIKAFTADFVRQLLIGLPNQALGLTLCSFISALGVDIIAQVE
AKDFGAESKVSVDDLCKKAVEHNIQVGKFSQLVMNRATVLASSYDTAWKKHDLVRRLETS
ISSCKTSLQRVQLHIAMFQWQHEDLLISRPQAMSVTPPRSAILTSMKKKLHALSQIETSI
GTVQEKLAALEASIEQRLKWAGGANPALAPVLQDFEATIAERRNLVLKESQRANQVTFLC
SNIIHFESLRTRTAEALSLDAALFELIKRCQQMCSFASQFNSSVSELELRLLQRVDTTLE
HPIGSSEWLLSAHKQLTQDMSTQRAVQTEKEQQIETVCETIQSLVDSVKTVLTGHNRQLG
DVKHLLKAMAKDEEAALADAEDIPYESSVRQFLAEYKSWQDNIQTVLFTLVQAMGQVRSQ
EHVEMLQEITPTLKELKTQSQSIYNNLVSFASPLVTDAANECSSPTSSATYQPSFAAAVR
SNTGQKTQPDVMSQNAKKLIQKNLATSADTPPSTIPGTGKSIACSPKKAVRDPKTGKAVQ
ERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
NT seq 10977 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcagagccccggggtctcggctgagcagcggcggcggcggcaccaagtacccg
cggagctggaatgactggcaacccagaactgatagtgcatcagccgacccagatacttta
aaatactcctcatctagagataggggtgtttcttcctcttatggactgcaaccttcaaat
tcagctgtggtgtctcggcaaaggcacgatgataccagaggccatgctgacatacagaat
gacgaaaagggtggctacagtgtcaatggaggatctggggaaaatacttatggtcggaag
tcgttggggcaagagctgaggattaacaatgtgaccagccctgagtttaccagtgttcag
catggcagtcgtgcattagccaccaaagacatgaggaaatcacaggagcgatcgatgtcg
tactctgatgagtctcgactgtcgaatcttcttcggaggatcacccgggaagatgacaga
gaccgaagactggctactgtaaagcagctgaaggagtttattcagcagccagaaaataaa
ctggtactagttaaacagttggataatatcttggctgctgttcatgatgtgctcaatgaa
agtagtaagttgcttcaggagttgaggcaagagggagcttgctgtctgggccttctctgt
gcttctctgagctacgaggctgagaagatcttcaagtggattttcagcaagtttagctca
tctgcgaaagatgaggtgaagctcctctacttgtgtgccacttacagagcgctggagact
gtgggggagaagaaagccttttcttcggtgatgcagcttgtgatgaccagcctacaatcc
atccttgaaaatgtggatacaccagaattactttgcaaatgtgttaagtgcattcttttg
gtggctcgttgctaccctcatattttcagcactaattttagggatacagttgatatatta
gttggatggcacatagatcatactcagaaaccctccctcacacagcaggtgtctgggtgg
ttgcagagtttggagccattttgggtagctgaccttgcattttctaccactcttcttggt
caatttttagaagacatggaggcatatgctgaggacctcagccatgtggcctctggggag
tcagtggatgaagatgttcctcctccatcagtgtcattaccaaagctggcagcacttctc
cgtgtgttcagtactgtggtgaggagcattggggaacgctttagcccaattcggggtcca
ccaattacagaggcatacgtaacagatgttctatacagagtaatgagatgcgtgacggct
gcaaaccaagtgtttttttctgaggctgtgttgacagctgctaatgagtgtgttggtgtt
ttgctcggcagcttggatcctagcatgactatacattgtgacatggtcattacatatgga
ttagaccaactggagaattgccagacttgtggtaccgattatatcatctcagtcttgaat
ttgctcacattgattgttgagcagataaatacaaaacttccatcgtcctttgtagaaaag
ctttttataccatcatctaaactactatttctacgataccacaaagaaaaagaggttgtt
gctgtagctcatgctgtttatcaagcagtgctcagcttgaagaatattcctgttctggag
actgcctataaattaattttgggagaaatgacttgtgcactaaacaatctgctacacagt
ctccagcttcctgatgcctgttctgagattaaacatgaggcttttcagaatcatgtgttc
aacattgacaatgccaactttgtagttatatttgatctcagtgcactgactacaattgga
aatgccaaaaactcattaattgggatgtgggcactgtctccaactgtatttgcactgctg
agtaagaatctgatgattgtgcatagtgacctggctgttcacttccctgccattcagtat
gcggtgctctacaccctgtattcccattgtaccaggcacgatcacttcatatccagtagt
cttagctcttcatccccttccttatttgatggtgcggtgattagtactgtaactacagcc
acaaagaaacatttctcaattatattaaatcttttgggaatattgctaaagaaagataat
cttaaccaggacacaaggaaattgttaatgacatgggctttggaagtggctgtattaatg
aagaagtctgaaacatatgcacctttattctcccttccatcttttcataaattttccaaa
ggccttttagccaacactcttgttgaagatgtgaatatctgcttgcaagcatgtagcagt
ctccatgcgttgtcctcttctttgccagatgatctgctacaaaggtgtgttgatgtctgc
cgtgttcagcttgtccatagtggaactcgtattcgacaggcctttgggaagctgttgaag
tcaattcctttagatgttgtactaagcaataataatcacacagagattcaggagatttct
ctagcattgagaagccacatgagtaaagcaccaagtaacacgttccaccctcaggacttt
tctgatgtcatcagtttcattttgtatggaaactctcaccgaacagggaaggacaattgg
ttagaaagattgttctatagctgccagaggctggataagcgtgaccaatccacaattccc
cgcaatcttctaaagacagatgctgtcctttggcagtgggctatttgggaagctgcgcag
tttactgttctttcaaagttgcgaaccccattgggcagagctcaggacacgttccagaca
attgaaggcatcattagaagtcttgcagcccacacactaaaccctgaccaggatgttagt
cagtggaccactgcagataatgatgaaggccatggaagcaatcagcttagacttgttctt
ctgcttcagtatctggagaacctggagaaattaatgtataatgcctatgagggatgtgcc
aatgcattaacatcacctcccaaggtcattaggacttttttctataccaatcgacagact
tgccaagactggctcactcggatccgcctctccatcatgagggttggattgttggcaggt
cagcctgcagtgacagtgaggcacggctttgacttacttactgaaatgaaaacaaatagt
ctaactcaggggagtgaattggaagtaactatcatgatggtggtagaagcactgtgtgag
ctccattgtcctgaagctatacagggaattgctgtctggtcatcttcagctgttggtaaa
aaccttctctggattaactcagtggcccagcaggctgaagggaggtttgaaaaggcctct
gtggagtaccaggagcacctgtgtgccatgacaggtgttgattgctgcatctccagcttt
gacaagtctgttctcacgttggccaatgctggacgtaacagtgccagccccaaacactct
ctaaatggtgaatccagaaaaactgtgctatccaaatcaattgactcttcccctgaagtt
atcagctacttaggaaataaggcttgtgagtgctacatctctattgctgactgggctgct
gtgcaggagtggcagaacgcagtccatgacctgaagaagaactccagcagcacctcactc
aatctgaaagccgatttcaactatatcaagtcactaagcagcttcgagtctggagagttt
gttgaatgcactgagcagttggaattattaccaggagaaaatattaatctacttgctgga
gggtcaaaagaaaaaatagatatgaaaaagctgcttcctaacatgctaagcccagaccca
cgggagcttcagaaatccattgaagtccaactgttgagaagctcggttttcctggcaact
gctttaaaccacatggaacaagatcagaaatggcagtccttaaccgaaaatgtggtaaag
tacttgaagcaaacctcacgcatcgctattggaccactaagattgtctactctaacggtg
tcacagtccttaccagtactgagcaccctgcagctgtactgctcatctgcactcgagaac
acagtttctaatagactttcaacagaggactgtcttatcccactctttagtgatgctctt
cgctcatgtaagcaacatgatgtgcggccatggatgcaggcactgagatataccatgtac
cagaatcaactgttagagaaaattaaagagcaaacagtaccaattagaagccatctcatg
gagttaggtctgacagcagcaaaatttgctagaaaacgggggaatgtgtcactggcgaca
agactgctggcacagtgcagtgaggttcagctgggaaagacaaccactgcccaggactta
gtccagcattttaaaaaactgtccactcaaggccaagtggatgaaaaatggggccctgag
cttgatattgaaaaaaccaaattgttatatacagcaggccagtcaacacatgcaatggaa
atgttgagttcttgtgctatatctttttgcaagtctgcgaaagctgagtatgcagtggct
aagtcaattctgaccctggctaaatgggtccaggcagaatggaaagagatttcgggacag
ctgaggcaggtgtacagagctcagcagcaacagaacctttctggcctttctactttgtct
aggaacatactcgctctaatagagctaccatctgctaatacagttggagaggagcaccct
cggattgagagtgagtctacagtgcatattggagttggagaacctgacttcattttggga
cagttgtatcacctgtcttcagtgcaggcacctgaagtagccaaatcttgggcagcattg
gctagttgggcttataggtggggcagaaaggtggttgacaatgccagtcagggagaaggt
gttcgtctgttgcctagagaaaaatctgaagttcaaaatctgcttccagatactataact
gaagaagagaaagagagaatatatggtattcttggacaagctgtatgtcggccagcagga
attcaggatgaagatataacacttcagataacagagagtgaagataatgaggacgatgac
atggtcgatgttatctggcggcagttaatatcaagctgcccttggctttctgaacttgat
gaaaatgcaactgaaggtgttattaaagtgtggcggaaagttgtggacagaatcttcagc
ctgtacaaattgtcttgcagtgcatattttactttccttaagctaaatgctggtcaggtt
ctgttagatgaggatgatcccaggctccatttaagtcacagagcagagcagagcactgat
gatgtgatagtgatggctaccctgcgactgctcaggttgctagtgaagcatgctggtgag
ctccggcagtatctggaacatggcttggagacaaccccgactgctccatggagaggcatt
attccacagcttttctcacgcttaaaccaccctgaagtgtatgtgcgccagagtatttgt
aacctcctttgccgcgtggcccaagattccccacacctcatattatatcctgcaatagta
ggaaccatatcacttagcagtgaatcccaggcttcaggaaataagtattcctctgcaatc
ccaactttacttggaaatattcaaggagaagaactgctggtttccgaatgtgaaggagga
agtcctcctgcttctcaggatagcaataaagatgaacctaaaagtggtttaaatgaagac
caggccatgatgcaggattgctacagcaaaattgtagataaactttcctctgccaaccca
acgatggttttacaggtccagatgcttgtggcagagcttcgtagggtcactgtactctgg
gatgagctctggctgggagttttgttacagcagcacatgtatgtcctgagacgaattcag
caactggaggacgaggtgaagagagtccagaacaacaacaccttgcgcaaagaagagaaa
attgccatcatgcgagagaagcacacagcactgatgaagcccatcgtgtttgctttggag
catgtgcggagcatcaccgctgcccctgcagagacacctcatgaaaagtggtttcaggat
aactatggtgatgccattgacaatgcccttgaaaaactaaagacgccatcaaatcctgcc
aagcctggaagcagctggattccattcaaagagataatgctgagtttgcaacagagagcg
cagaaacgagcaagctacatcttgcgacttgatgagatcagtccttggttggctgccatg
actaacactgaaattgcacttcctggagaagtctcagccagagatactgtgacaattcac
agtgtgggtggaactatcaccatcttaccaactaaaaccaagcccaagaaactcctcttt
cttggatcagatgggaagagctatccttatcttttcaaaggactagaagatttgcatctg
gatgagagaatcatgcagtttttatctattgtgaatactatgtttgctacaattaaccgg
caggaaacaccccgcttccatgcacgccactattctgtaacaccactgggaacgagatca
gggctgatccagtgggtggatggagccacaccattgtttggtctttacaaacgatggcaa
caacgggaagctgccttacaagcacaaaaggcccaagattcctaccaaactcctcagaat
cccagcattgtacctcgtcctagtgaactttactatagtaaaattggtcctgctttgaaa
acagttggccttagcctggatgtgtcaaggagggattggcccctccacgtgatgaaggca
gtgttggaggagttaatggaggccacacccccaaatctcctggccaaggaactctggtca
tcttgcaccactcctgatgagtggtggagagtcacacagtcctatgcgagatccaccgct
gtcatgtccatggttggctacataattggtcttggagacagacatctggataatgtcctc
atagatatgacaactggagaagtagttcacatagattacaatgtttgctttgaaaaaggt
aaaagccttagagttcccgagaaagtgccttttcgaatgacacaaaacattgaaacagca
ctgggtgtaactggagtagaaggtgtttttaggctttcctgtgagcaggttctccacatc
atgcggcgaggccgagagactctgctgacactcttggaggcttttgtgtatgaccccctg
gtggactggacagctggtggtgaggctgggtttgcaggtgctgtctatggtggaggtggc
cagcaggctgagagcaagcagagtaagcgagagatggaacgtgagattacccgcagcctc
ttttcttccagagttgctgagattaaggtgaactggtttaagaaccgggatgagatgctg
gttgtgcttcccaagctggacagcagcttagatgaatacctaagcctgcaggagcagctc
acagatgttgaaaaactgcagggcaaactgctggaagaaatagaatttctagaaggagct
gaaggagtggaccatccatctcatactctgcaacacaggtattctgagcatactcaacta
cagacccagcaaagagctgttcaggaagcaatccaagtgaagctgaatgagtttgaacag
tggataacacattatcaggctgcattcaataacttagaagcaactcagcttgcaagtttg
cttcaagagataagcacacaaatggaccttggtcccccaagctatgtaccagcaacagcc
tttctacagaatgctgggcaagcacacctcatcagccagtgtgagcagctagagggggaa
gttggcgctctgctgcagcagaggcgttctgtgctccgtggctgtctggaacagctgcat
cactatgcaacagttgctctgcagtatccaaaagccatatttcagaaacatcgaattgaa
cagtggaaggcctggatggaagagctcatctgcaacaccacagtagagcgctgtcaagaa
ctctataggaagtatgaaatgcagtatgctcctcagccacctccaacagtgtgtcagttc
attactgctactgaaatgacccttcagcggtatgcagcagacataaacagcagacttatt
agacaagtggaacgtttgaaacaagaagctgtcactgtgccagtttgtgaagatcagttg
aaagaaattgagcgttgcattaaagtttttcttcatgagaatggagaagaaggctctctg
agtctagcaagtgtcattatttctgccctttgtactcttacaaggcgtaaccttatgatg
gaaggtgcagcttcaagtgctggagagcagctggttgatctgacatccagagatggagcc
tggtttctagaggagctgtgtagtatgagtggaaatgtcacctgcttggtgcagttactg
aagcagtgccacctggtaccacaggacttggatattcccaacccagtggaagcatctgag
gctgttcatttagccaatggagtatatacatctctgcaggaattaaattcaaatttccgg
caaatcatattcccagaagcacttagatgtttaatgaagggggagtgcaccttagaaagt
atgctccatgaactagatagtctgatcgagcagactactgatggagttcctctgcagact
ctggttgagtcacttcaagcctacttgcgaaacacagccatgggacttgaagaagaaact
catgctcattatattgatgttgccagaatgctacatgctcaatatggtgaattaatccaa
ccaagaaatggttcagttgatgaaacaccaaaaatgtcagctggccagatgcttttggta
gcatttgatggcatgtttgcccaagttgaaactgcttttggcttattagttgagaagcta
aacaagatggaaattcctgttgcttggcggaagattgacattattcgggaagccaggagt
acccaggtcaatttttttgatgatgacaatcaccggcaggtgctagaagagattttcttt
ttaaaaagactacagacaattaaggagttcttcaggctctgtggtaccttttctaaaaca
ttgtcaggatcaagttcacttgaagatcagaatactgtgaatggacctgttcagattgtc
aatgtgaaaaccctttttagaaattcttgctttagtgaagaccaaatggccaagcctatc
aaggcctttacagctgactttgtaagacagctcttgataggactcccaaaccaagccctc
ggactcacattgtgtagctttatcagtgccctgggtgttgacatcattgctcaggtagag
gcaaaggactttggtgctgaaagcaaagtttctgtagatgatctgtgtaagaaagctgtg
gagcacaatatccaggtagggaaattctcacagttggtgatgaacagagctacagtgtta
gccagctcctatgatacagcatggaagaagcatgacctggtgcgcaggctggaaaccagc
atttcttcctgcaagacaagcctgcagcgggtgcaactgcacattgccatgttccagtgg
cagcatgaagacctccttatcagcagaccacaagccatgtcagtcaccccgcctcggtct
gcaatcctgaccagcatgaagaagaaactgcatgctctcagtcagattgagacttcaatt
gggacggttcaggagaaactagcagcccttgaagcaagcattgagcagcggctgaagtgg
gcaggtggtgccaatcctgccctggcaccagtactacaagattttgaagcaacaatagct
gaaagaagaaatcttgttctcaaagagagccagagagcaaaccaggtcacttttctctgc
agcaatatcattcattttgaaagtctacgaacaagaactgccgaagccttaagcctggat
gctgccttatttgaactaatcaaacggtgtcagcagatgtgttcatttgcgtcacagttc
aacagttcagtttccgagttagagcttcgtttattacagagagtggacactactcttgaa
catcctattggcagttctgagtggcttctatcagcacataaacaattgacccaggatatg
tccacccaaagagctgttcaaacagagaaggagcagcagatagagactgtctgtgagacc
atccagagcctagtcgacagtgtaaagactgtgctcaccggtcacaaccggcagcttgga
gatgtgaagcatctcttgaaagccatggctaaggatgaagaggctgctctagcagatgct
gaagatattccctatgagagcagtgtcaggcagttcctggctgaatacaaatcatggcaa
gacaacattcagacggttttgttcacactagtccaggccatgggtcaggttcgaagtcaa
gaacatgttgaaatgctgcaggaaatcactcccaccttgaaagaattgaagacacaaagc
cagagtatctataataatttagtgagttttgcatcacccctagtcaccgatgcagcaaat
gaatgttcaagtccaacatcatctgcaacttaccagccatcctttgctgcagcggttagg
agtaacactggccagaagactcagcctgatgtcatgtctcagaatgctaaaaagctgatt
cagaaaaatctggctacatcagcagatactccaccaagcaccatcccaggaactggcaag
agcatcgcctgtagtcctaaaaaggctgtcagagaccctaagactgggaaagctgtgcaa
gagagaaactcctatgcagtgagtgtgtggaagagagtgaaagccaagctagagggccga
gatgttgatccaaacaggaggatgtcagttgctgagcaggttgactatgtcattaaggaa
gcaactaatctagataacttggctcagctgtatgaaggttggacagcttgggtgtga

DBGET integrated database retrieval system