KEGG   Mus musculus (mouse): 233865Help
Entry
233865            CDS       T01002                                 

Gene name
D430042O09Rik, Kiaa0556
Definition
(RefSeq) RIKEN cDNA D430042O09 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F3
AA seq 1610 aa AA seqDB search
MDGQALRKVERSRSCSQERKEGYSKDMVTDFDEKHDEYLILLQQRNRILKHLKAKDPVQL
RLEHLEQGFSVYVNGANSELKTSPRKAVHTDFSRSASQAEGSQDYGRRTLFREAEEVLRR
SSRTAPGKVQRRGWHQKSVQIRTEAGSRLHIEPPLDCSEDFESQEDVIGKHEDATGEHTQ
ELRKGLGLSTSLQTQEDGSSDEYDSIEEDVLSETETEDPVLPVHNRDECPLPSHDAVQKD
VPKDQELEGRHPQATDTLVVMEFNPASKGNKMDRILSAKRKENAEVFIPSKPDSVLNPQP
PAVFPEQERACSRSGSRRDRPLSATRKAYAAEDREEDASAVLKAIQVENEALQQVFLSHD
PELHTSPQQDTKEPPAKSWSSLLKAKEDIPELLPATPVTTDPELCRAAAGAKAVSQAMDG
MSPLGSRQQHKLVGVLQTMESDTTHLSQVAIPTEKPVPNSEEKWKARVDEIEDAIYVTME
ILSNWGNASWVGLTEVQFFDLNNIKLYVSPHDVDIRNAVLPGELGCLVNRDLVSKKDPPV
WTCPFHPPLQLYFIIHNMRQLRDFGLTMIKVRNYWTADGDLDIGAKNVKLYVNKSLIFDG
VLEKGGGEAPSDCTIPVDLQRERNESSDKALSTGWKESKGALKMAALSDARELGLSCSQP
AESLDMTVSSQGDFLGEKVNSTSGLKNSLSKLQEDVRLLATPASMGDGPSVPSSSSPGKC
LPLEEEPSLIQQLESLRGRKIPEPTGKTPHWLQPSLAGMGKKQTVRKPKPLWLSPEKDLE
QKSRFPSEDVMGDTPGEVETREKGPRREQGRTSSWNVITEERAPKAFSKACGDDLDIFSQ
LPNRDRPASGRRALKKEASSSHGDDRPASKEDTQASQTLPWLQWYGEQEHALHASWDSLT
AFDRAHRGRISALEPQGDILDEFLKQQRSSRHEEFPAPCREEEPEPSTEMGGDSDFKIPV
LPYGQHLVIDIKSTWGDRHYVGLNGIEIFSSSGEPVQISSITADPPDINILPAYGKDPRV
VSNLIDGVNRTQDDMHVWLAPFTPGMTHTISIEFTHPCQVALIRIWNYNKSRIHSFRGVK
DITMLLDTQCIFEGEIAKASGTLMGAPEHFGDTILFTMDEDILEAIFCLDDTFDMDAESL
CGLQPEEALRRPSTADGEGQDERPFTQAGLGAQDQVPGLELQTSPPVSEVTTPEPGIFYG
LCLRLNLTASWGDLHYIGLTGLEVVGKDGEALPIQPHQLSASPRDLNDLPEYNDDSRTLD
KLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIA
HVSLDGLCVSPAEGFLIRKGPGNCHFDFAQEILFGDYLQTRLPPAPTRRLDAKSLERASM
DYEAPLMPCGFIFQFQLLSSWGDPYYIGLTGLELYDEHGERIPLSQNNIAAFPDSVNALE
GVCGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYTKTP
QRGVKEFGLLVDDLLVYNGILAMVSHLVGGILPTCEPTVPHHTILFAEDTDFCHQEKHAI
ISKPEEDQDIQMMNENQVITTSRRKPGTADPALRPKTCIREKETSRRWRC
NT seq 4833 nt NT seq  +upstreamnt  +downstreamnt
atggacggtcaggccctgcggaaggtggagagaagccggtcctgctctcaggagagaaag
gagggttacagtaaggacatggtgacagactttgatgagaaacatgatgagtatttaata
ttgcttcagcagagaaaccggatactaaagcatttgaaagccaaggaccctgtgcagctg
aggctggaacacttggagcaaggtttctctgtctatgtcaatggggccaactcggagctg
aagacatcaccacggaaagctgtgcatacagacttctccagaagtgcctcacaggctgag
gggtcacaggattatggacgaagaaccctattccgagaagccgaagaagtcttaagacgc
agctccaggacagcaccaggaaaagtccagcgccgaggatggcaccagaaatctgtgcag
atcagaactgaagctggctctcgtctccacattgaacctcctctggactgttcagaagat
tttgaatcacaagaagatgtgattggcaagcatgaggatgccactggggagcacacacag
gagctgagaaaaggcctggggctcagcacaagcctccagacccaagaggacggctccagc
gacgagtacgactctattgaggaagacgtcctctctgagacggagactgaggaccctgtc
ctgccagtccacaacagagatgaatgtccacttcccagccatgatgcagtacagaaggat
gtccccaaggaccaggaactggaaggccggcatccccaggccacagacacccttgtggta
atggagtttaacccagcttctaaaggtaataagatggaccggattttatctgctaagcgg
aaggagaatgctgaggtcttcatccccagcaaaccagactctgtcctgaatccacagccc
ccagctgtgttcccagagcaggagagagcctgttccagatctggaagccggagagataga
cccttgtcagcaacccgcaaagcatatgcagctgaggaccgagaggaagatgcctcggct
gtgctgaaagccatccaggtggagaacgaagctctgcaacaggtcttcctcagccacgat
cctgagctacataccagtccacagcaggataccaaggaaccaccagcaaaatcctggtcc
agtctgctgaaggccaaggaggacatccctgagctgcttcctgctactccagtgaccacc
gatcctgagctgtgcagagcagcagcaggagccaaagctgtcagccaagccatggacgga
atgagccctttgggaagcagacaacagcataaacttgtgggagtcttgcagactatggaa
agtgacactacccatctcagccaggtggctataccaacagagaagccagtaccaaattca
gaggaaaagtggaaagcaagagtagatgagatcgaagatgccatctatgtgactatggaa
atcctgtctaactggggcaatgcatcatgggtgggtctcacagaagtccagttctttgat
ctgaacaacataaagctttatgtctcacctcatgatgtggacatccggaatgcagtgttg
ccaggcgaactggggtgccttgtcaacagggacttagtgagcaagaaggacccccctgtg
tggacctgccccttccacccaccacttcagctctatttcattattcacaacatgcgacag
cttcgtgacttcggtctgaccatgatcaaggttcggaattactggacagcagatggggat
cttgacattggtgctaagaacgtgaaactctatgtcaacaaaagcctcatctttgatggc
gtgttagagaaaggaggaggtgaagccccttctgattgtaccatccccgtggaccttcag
agagagaggaatgagagctcagacaaggccttgagcactggctggaaagaaagcaaaggt
gccctcaagatggctgccttgagtgatgctagggagcttgggctcagctgctcacagcca
gcggaatccttggatatgacagtttcctcacaaggagatttccttggtgaaaaggtgaat
tctacatctggcctgaagaacagtttgtccaagttacaggaagatgtaagactgttggca
acccctgcctctatgggtgatgggcccagtgtcccttcttcatcctctcctgggaaatgt
cttcctctagaagaggagccctctttgatccaacagctggaaagtctcagaggtaggaaa
atccccgaaccgaccgggaaaaccccacactggttacagccttctctagcagggatgggc
aagaaacagacagtcaggaagcccaaacccctgtggctcagtcctgaaaaagatctggaa
cagaagagcaggtttccatctgaggatgtcatgggtgatactcctggagaggtggagacc
agggaaaaaggccctcgtcgtgagcaagggaggactagcagctggaatgtcatcactgaa
gagagagcccccaaagcattctccaaagcctgtggcgatgacttagacatctttagccag
cttcctaacagggatcgccctgctagtgggaggagggccctgaagaaggaagccagcagt
agccatggtgatgaccggccagccagcaaagaagacacccaggcctcccagacactgcct
tggttgcagtggtatggtgagcaggaacacgcactgcatgcatcatgggactccctcact
gccttcgaccgtgcccaccggggcagaatctctgccctggaaccacagggggacatccta
gatgagttcctgaagcagcaaaggagcagccggcatgaggaattcccagccccttgcaga
gaggaggagccagagccctccacagagatgggtggtgacagcgactttaaaatcccagtc
ctcccttatggacagcacttggttattgacatcaagtctacatggggagacagacactat
gttggccttaacggcatagaaatattcagctcctcaggggaaccagtacagatttccagc
ataacggcagacccccctgacatcaatattttaccagcttatgggaaagacccacgtgta
gtctccaacctcattgatggggtgaacaggacccaggatgacatgcatgtctggctggcc
cccttcacaccaggcatgacccacaccatctccattgagttcacacacccttgccaagtt
gccctgattaggatttggaattacaataagtctcgaatccactccttccgaggtgtgaag
gacatcacgatgctgttggatactcagtgcatctttgaaggagaaattgccaaagcctca
ggaactctgatgggagcccctgagcactttggagacactattctcttcaccatggatgag
gacatcctggaggccatattctgtttggatgatacttttgacatggatgctgagagcctg
tgtggccttcagcctgaagaagcgctaaggaggcccagcactgccgacggtgaaggtcag
gatgaaaggcctttcacacaggctggcttgggtgcccaggaccaggtaccagggctagag
ctacaaaccagcccccctgtctctgaagtcaccacacctgagccaggcatcttctatggg
ttatgcctccgactaaacttgacagcctcctggggggacctgcactacataggactcact
ggcctagaagtagtaggcaaggacggcgaggccttgcccattcaaccacaccagctctct
gcctctcccagggacttaaatgacctgcccgagtacaacgatgactcacggaccctggac
aagttaatcgatggcatgaacatcaccaccgaggatgagcacatgtggctgatccccttt
tcccctgggttggaccatgtggttatgatccactttgacagagcccaaagcattgctggc
ctgcgtctctggaactacaataaatctcccgaggacacctaccgaggggtcaaaatcgct
catgtgtccctggatggcctgtgcgtgtctcctgcagaaggctttctcatccgaaagggg
cctggcaactgtcactttgattttgcacaagaaatcctttttggggactacctacagacc
cggctaccaccagcacccaccaggagactagatgcaaagagcctggagcgagccagcatg
gactacgaggccccactcatgccctgtggcttcattttccagttccagctgctgtccagc
tggggcgatccctactacatcggcctcacagggctggagctgtatgacgagcatggggag
aggatcccattgtcccagaacaatattgctgccttcccagacagtgtgaatgcgctagag
ggtgtttgcggggatgtgagaacccctgacaagcttatcgaccaagtcaacgacaccagc
gatggcaggcacatgtggttggcccccatcctgcctggcctggtgaaccgagtgtatgtc
attttcgacctgcccaccactgtgtcaatgatcaaactgtggaattacacgaaaacgcct
caacgaggagtgaaggagtttggcctgctggtggatgacctgcttgtgtacaacggcatc
cttgccatggtgagccacctggttgggggcatcctgcccacgtgtgagcctaccgtgccc
caccacaccatcctttttgctgaggacactgacttctgtcaccaggagaaacacgccatc
atcagtaagccggaggaagaccaggacatacaaatgatgaatgaaaaccaggtcatcact
acctcgaggaggaagccaggcactgctgacccagccttacgccctaaaacctgcatacgt
gagaaggagacctcaaggcgttggcggtgctga

DBGET integrated database retrieval system