KEGG   Mus musculus (mouse): 233871Help
Entry
233871            CDS       T01002                                 

Gene name
Atxn2l, A2D, A2LG, A2RP, A2lp, Atxnl2
Definition
(RefSeq) ataxin 2-like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F3
AA seq 1049 aa AA seqDB search
MLKPQPPQQTSQPQQPPPTQQAVARRSPGGTSPPNGGLPGPLTATAAPPGPPAAVSPCLG
PAAAAGSGLRRGAESILAASAPPQHQERPGAVAIGSVRGQTTGKGPPQSPVFEGVYNNSR
MLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDT
MVFKPSDVLLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYD
LESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLARE
IESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLVSREGKYIPLPQRVREGPRG
GVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAKTL
SSPSNRPSGEASVPPTSAALPFLPVGRMYPPRSPKSAAPAPVSASCPEPPIGSAVASSAS
IPVTSSVVDPGAGSISPASPKLSLTPTDVKELPTKEPSRNLEAQELARIAGKVPGLQNEQ
KRFQLEELRKFGAQFKLQPSSSPETGLDPFPSRILKEEAKGKEKEVDGLLTSDPMGSPVS
SKTESILDKEDKVPMAGVGGTEGPEQLPAPCPSQTGSPPVGLIKGDEKEEGPVTEQVKKS
TLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQI
HMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAAGP
PLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVS
SSTPQYPAAEQPTPQALYATVHQSYPHHATQLHGHQPQPATTPTGSQPQSQHAAPSPVQH
QAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHPHQQLPH
GFTNMAHVTQAHVQTGVTAAPPPHPGAPHPPQVMLLHPPQGHGGPPQGAVPPSGVPALSA
STPSPYPYIGHPQVQSHPSQQLPFHPPGN
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcctcagccgccacaacagacctcccaaccccagcagccgccccccacgcaa
caggccgtggctcgccggtctcccggcgggaccagccctcccaacggcggcctcccggga
ccgctgaccgccaccgcggctcccccggggcctcccgcagcggtctctccgtgcctgggg
cctgcagccgctgccggcagcggacttcgccgcggagccgaaagcatcttagcggcgtca
gcgccgccgcagcatcaagaaaggccaggggcagtggctatcggcagcgtcaggggacag
accaccggaaagggacccccacagtcacccgtgtttgaaggtgtctataacaattccagg
atgctgcatttcctgacagctgtagtgggttctacttgtgacgtaaaggtgaaaaatggc
accacttacgagggcattttcaagactctgagctcaaagtttgaactggcagttgacgcg
gtgcatcggaaagcatctgagccagcaggtgggcctcgccgggaagacattgtggacacc
atggtgtttaaaccaagcgacgttctgcttgtccacttccgaaatgttgacttcaattat
gctactaaagataagttcactgactcagccattgccatgaactctaaggtgaatggagaa
cacaaagagaaggtgcttcaacgttgggagggcggtgacagcaacagtgacgactacgat
ctggaatccgatatgtctaatggatgggatcccaatgagatgttcaaatttaatgaggag
aactatggagtgaagaccacctatgacagcagtctatcttcttacacggttcccttagaa
aaggacaactctgaagagtttcggcagcgggagcttcgagcggcccagttggctcgagag
attgagtctagtccccagtaccgcctacggattgctatggaaaatgacgatgggagaaca
gaggaggagaagcacagtgctgttcagcggcaggggtctgggcgggagagccccagcttg
gtatccagggaggggaagtatatccccctgcctcagcgagttcgagaaggtccccgggga
ggagttcgatgcagcagttctcgaggagggcgccctggccttagctctttgccacctcgt
ggccctcaccatcttgacaacagcagtcctggccctgggtctgaggcacgtggtatcaat
ggaggtccttcccgcatgtcccccaaggcacagcggcctctgagaggtgccaagacctta
tcttcacccagcaataggccttctggagaagcttctgttcctccaacatctgcagctctc
ccttttcttccagtgggccggatgtaccctccacggtctcccaagtctgctgcccctgcc
ccagtctcagcttcctgtcctgagcctcccattggttcggcagtggcgtcctctgcctcc
atccctgtgacatcatcagttgtggatcctggtgcaggctctatttccccggcatctcca
aaactctccctgacccctacagatgtaaaagaactcccaaccaaggagcccagtaggaat
ttggaagcccaagaactggcccgcatagctgggaaagtccctggccttcagaatgaacaa
aaacgatttcagttggaagaactgagaaaatttggggcccagtttaagcttcaacctagt
agctcccctgagacgggcctggatccatttccttcccggatcttgaaagaagaggccaaa
ggaaaggagaaagaggtggatggtctattgacttcagatcctatgggatccccagtctcc
tctaagacagaatccatattggataaggaagacaaagtgcccatggcaggagtaggaggg
actgaggggccagagcagctcccagcaccttgtcccagccaaaccggcagtcctccagtg
ggcctcatcaagggggatgagaaagaggagggccctgttactgaacaagtgaagaagtct
actttgaaccccaacgccaaggagttcaatccaacaaaacctctgctgtctgtgaacaaa
tctaccagtactccaacttcaccagggccccgtactcattcaacaccttctataccggtg
ctgacagcaggccagagtgggctctacagtccccagtacatctcatatatacctcagatc
cacatgggaccagctgtacaggcgcctcagatgtatccatatcctgtatccaattccgtg
cctgggcagcagggcaagtaccggggtgcaaaaggctcacttcctcctcagcgctctgac
caacaccaaccagcctcagcccctccaatgatgcaggctgctgctgctgctgctggccca
cccctggtggctgccacaccctattcctcctacatcccctacaacccacagcagttccca
ggccagcctgccatgatgcagcccatggcacactacccttcacagccggtgttcgcccct
atgcttcaaagtaatccacgaatgttgacatcgggaagccatccccaggccatcgtgtcg
tcctccactcctcagtaccctgctgcagagcagcctaccccccaagccctctatgccact
gttcaccaatcctatccacaccatgccacgcagctccatggccaccagccgcagccggcc
accacacctactgggagccagccacaatcccagcatgcggcccccagtcccgttcagcac
caggcggggcaggcccctcacctgggcagtggacagccacagcagaatctgtaccatcca
ggggccctaacaggcacgccaccttctctaccaccgggaccttctgcccagtcccctcaa
agcagcttcccccagccagctgctgtgtatgccatccatccccaccagcagctgccccac
ggcttcaccaacatggcccatgttacccaggcccatgtccaaactggagtcacagcagcc
ccgcccccacaccctggggctccccacccgccccaggtgatgctgctgcaccccccccag
ggccatggggggcccccccaaggcgcggtgcccccgagtggggtgcctgcactctcagct
tccacaccctcaccctacccctacatcggacacccccaagttcaatctcatccctcccag
cagctccccttccaccccccggggaactga

DBGET integrated database retrieval system