KEGG   Mus musculus (mouse): 233908Help
Entry
233908            CDS       T01002                                 

Gene name
Fus, D430004D17Rik, D930039C12Rik, Fus1, Tls
Definition
(RefSeq) fused in sarcoma
  KO
K13098  
RNA-binding protein FUS
Organism
mmu  Mus musculus (mouse)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    233908 (Fus)
Spliceosome [BR:mmu03041]
 Complex A
  Other components
   Complex A specific factors
    233908 (Fus)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F3
AA seq 518 aa AA seqDB search
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYG
QTQNTGYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGGSSQS
SSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGGNYGQ
DQSSMSGGGGGGGYGNQDQSGGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGG
RGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQ
IGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVS
FATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWK
CPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGRGGYDRGGYRGRG
GDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaacgactatacccaacaagcaactcaaagctacggggcctatcctacccag
cctgggcagggctactcccaacagagcagtcagccctatggccaacagagttacagtggt
tatggccagtcagctgacacttcaggatacggccagagcagctatggttcttcttatgga
cagacccaaaacacaggctatggaactcagtcagctccccagggatatggttccactgga
ggctatggcagcagccaaagttcacaatcttcttatgggcagcagtcctcctaccctggc
tatggccaacagccagctcctagcagcacctcaggaagttatggtggcagttctcagagc
agcagctatgggcaaccccagagtggaggttatggtcaacagtctggctatggtggacag
caacaaagctacggacaacaacaaagctcctataacccacctcagggttatggacaacag
aaccagtacaacagtagcagtggaggtggtggagggggtggtggaggcaactatggccaa
gatcagtcctctatgagtggtggcggtggcggtggtggttatggcaatcaggaccagagt
ggtggcggcggcggcggctacgggggaggccaacaggatcgtgggggccgaggcaggggc
ggtggaggtggttacaaccgaagcagtggtggctatgaacccagaggccgtggaggtggc
cgaggaggcagaggcggcatgggcggaagtgaccgcggtggcttcaataaatttggtggt
cctcgggatcaaggatctcgtcatgattctgaacaggataattcagacaacaataccatc
ttcgtgcaaggcctaggcgagaatgttacaattgaatctgtggctgattacttcaagcag
attggaattattaagacaaacaagaaaactggacagcctatgattaatttgtacacagac
agggaaactggcaagttgaagggtgaggcaacagtttcatttgatgacccaccttctgct
aaagcagctatcgactggtttgatggtaaagaattctctgggaatcctattaaagtttca
tttgctacccgccgagctgacttcaatcggggtggtggaaatggtcgcggaggccgaggg
cgaggaggacccatgggccgtggaggctatggaggaggtggcagtggtggtggtggccgg
ggaggattccccagtggaggtggtggaggtggaggacagcaacgagctggagactggaag
tgtcctaatcctacatgtgagaacatgaacttctcttggagaaatgaatgcaaccagtgt
aaggcacctaagccagatggcccaggagggggaccaggaggctctcatatggggggaaac
tatggagatgatcgacgtggcagaggaggatatgaccggggcggctaccggggccgagga
ggggaccgtgggggcttcagagggggccggggtggtggggacagaggcggttttggccct
ggcaagatggactccaggggcgagcacagacaggatcgcagggagaggccatattag

DBGET integrated database retrieval system